Recombinant Human Peroxisomal membrane protein PEX16 (PEX16)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PEX16; Peroxisomal membrane protein PEX16; Peroxin-16; Peroxisomal biogenesis factor 16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PEX16
Target Protein Sequence
MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLL NDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALVQLAK AVLRMLLLLWFKAGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQN TPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAEFLYIARPLLHLLSLGLWGQ RSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTILLLYYLLRSPFYDRFSEARIL FLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG
Uniprot No.

Target Background

Function

PEX16 is essential for peroxisome membrane biogenesis and may play a role in the early stages of peroxisome assembly. It facilitates the recruitment of other peroxisomal proteins, such as PEX3 and PMP34, to nascent peroxisomes originating from the endoplasmic reticulum (ER). It may also function as a receptor for PEX3.

Gene References Into Functions
  1. RNAi-mediated knockdown of Sec16B (but not Sec16A) altered peroxisome morphology, inhibited Pex16 transport from the ER to peroxisomes, and suppressed Pex3 expression. PMID: 21768384
  2. An unusual variant peroxisome biogenesis disorder, caused by PEX16 gene mutations, exhibiting a relatively mild clinical phenotype and an unexpected fibroblast phenotype, was identified. PMID: 20647552
  3. Aberrant splicing mutations in the PEX16 gene were identified in patients with Zellweger syndrome. PMID: 11890679
  4. Pex16p functions in peroxisome membrane assembly, likely upstream of Pex3p. PMID: 12223482
  5. PEX16 regulates peroxisome assembly through cotranslational insertion into the ER, recruiting other peroxisomal membrane proteins. PMID: 16717127
Database Links

HGNC: 8857

OMIM: 603360

KEGG: hsa:9409

STRING: 9606.ENSP00000241041

UniGene: Hs.100915

Involvement In Disease
Peroxisome biogenesis disorder complementation group 9 (PBD-CG9); Peroxisome biogenesis disorder 8A (PBD8A); Peroxisome biogenesis disorder 8B (PBD8B)
Protein Families
Peroxin-16 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the fundamental role of PEX16 in peroxisome biogenesis?

PEX16 is a multifaceted regulator of peroxisome biogenesis that functions differently across species. In humans, PEX16 is an integral membrane protein that acts as a critical receptor during the early stages of de novo peroxisome formation at the endoplasmic reticulum (ER). It serves as the "master" peroxin responsible for initiating peroxisome biogenesis by facilitating the recruitment of PEX3 and subsequently other peroxisomal membrane proteins (PMPs) to both the ER and mature peroxisomes .

The protein contains at least two transmembrane domains with both N and C termini facing the cytosol. Human PEX16 is inserted into the ER co-translationally via the SEC61 complex and is required for the subsequent recruitment of PEX3, which in turn enables the insertion of other PMPs. Without PEX16, cells completely lack peroxisomal structures, highlighting its essential role in peroxisome formation .

  • How does PEX16 function differ between humans, yeast, and plants?

The functional differences of PEX16 across species represent a fascinating evolutionary divergence in peroxisome biogenesis pathways:

SpeciesCellular LocalizationMembrane AssociationPrimary FunctionInsertion Mechanism
Humans (H. sapiens)ER and peroxisomesIntegral membrane proteinPMP receptor at ER and peroxisomesCo-translational insertion at ER
Yeast (Y. lipolytica)Peroxisomal membranePeripheral membrane proteinRegulator of peroxisome divisionPost-translational insertion
Plants (A. thaliana)ER and peroxisomesIntegral membrane proteinPMP receptor; required for other ER-derived organellesPost-translational insertion to ER

In Yarrowia lipolytica, PEX16 is an intraperoxisomal peripheral membrane protein involved in peroxisomal fission rather than formation. Notably, some yeast species like Saccharomyces cerevisiae lack a PEX16 homolog entirely, suggesting alternative mechanisms for peroxisome biogenesis .

In Arabidopsis thaliana, PEX16 serves dual functions similar to human PEX16 but with additional roles in the formation of other ER-derived organelles such as oil and protein bodies. This expanded functionality makes plant PEX16 particularly intriguing for researchers studying organelle biogenesis beyond peroxisomes .

  • What experimental systems are available for studying PEX16 function?

Several experimental systems have proven effective for studying PEX16 function:

  • Cell culture models: Human fibroblasts, particularly from Zellweger syndrome patients with PEX16 mutations, provide valuable insights into PEX16 function. The CG-D complementation group fibroblasts have been effectively used to study the consequences of PEX16 deficiency .

  • Mouse models: Conditional or tissue-specific knockout models, particularly in adipose tissue, have revealed PEX16's role in adipocyte development and lipid metabolism .

  • Plant models: Viable Arabidopsis pex16 mutants with negligible PEX16 protein levels display impaired peroxisome function without lethality, making them excellent models for studying PEX16 function post-embryogenesis .

  • Yeast systems: Y. lipolytica provides a powerful model for studying PEX16's role in peroxisome division, with the advantage of simplified genetic manipulation .

For protein interaction studies, researchers commonly employ co-immunoprecipitation, yeast two-hybrid analysis, and fluorescence microscopy with epitope-tagged PEX16 constructs to visualize its cellular distribution and dynamics .

  • What are the common methods for detecting and quantifying PEX16 expression?

Detection and quantification of PEX16 can be accomplished through several methods:

  • Immunoblotting: Using antibodies against specific regions of PEX16, such as the N-terminal region before the first transmembrane domain. This technique can detect the ~40 kDa protein (expected 41.6 kDa) in wild-type cells .

  • Reverse transcriptase PCR (RT-PCR): For analyzing PEX16 mRNA expression levels and splicing variants, particularly useful when studying mutations that affect splicing, as observed in the pex16-1 mutant in Arabidopsis .

  • Fluorescence microscopy: Using epitope-tagged PEX16 constructs (e.g., GFP or myc-tag fusions) to visualize the subcellular localization of PEX16 in living cells .

  • Pulse-chase experiments: For studying the synthesis, insertion, and trafficking of PEX16 between the ER and peroxisomes .

The expression levels of PEX16 can vary during development, with higher levels typically observed in younger tissues or during specific developmental stages, such as early seedling development in plants .

Advanced Research Questions

  • What are the molecular mechanisms underlying PEX16-mediated recruitment of peroxisomal membrane proteins?

PEX16 functions through multiple domains to facilitate the recruitment and insertion of peroxisomal membrane proteins (PMPs). In humans, PEX16 mediates two distinct PMP trafficking pathways:

  • PEX3-dependent pathway: PEX16 acts as a receptor for PEX3 at the ER in a PEX19-independent manner. Once PEX3 is recruited to the ER by PEX16, it can subsequently facilitate the recruitment of additional PMPs (group I PMPs) that follow the ER-to-peroxisome pathway .

  • Direct PMP recruitment: PEX16 can also directly recruit select PMPs to the ER membrane independent of PEX3 and PEX19, suggesting a multifaceted role in PMP trafficking .

At mature peroxisomes, PEX16 continues to function as a receptor for PEX3, but through a different mechanism that is PEX19-dependent. This creates what researchers have termed a "chicken-or-the-egg" dilemma in understanding the spatiotemporal regulation of these peroxins .

A comprehensive mutational analysis has revealed that multiple domains in PEX16 mediate its trafficking and recruitment functions. These domains are responsible for:

  • Targeting PEX16 to the ER

  • ER-to-peroxisome trafficking

  • PMP recruitment at the ER

  • Interaction with specific cargo proteins

Understanding these molecular mechanisms requires sophisticated approaches including domain mapping, site-directed mutagenesis, and real-time imaging of protein-protein interactions in living cells.

  • How can researchers effectively design experiments to study the differential trafficking of PEX16 between the ER and peroxisomes?

Designing experiments to study PEX16 trafficking requires careful consideration of several factors:

Fluorescent protein tagging strategies:

  • Use photoactivatable or photoconvertible fluorescent proteins (e.g., PA-GFP or mEos) fused to PEX16 to track its movement from the ER to peroxisomes in real-time

  • Implement split-GFP complementation assays to visualize PEX16 interactions with other proteins during trafficking

  • Consider the position of the tag (N- or C-terminal) as it may affect trafficking and function

Pulse-chase experiments:

  • Employ the RUSH (Retention Using Selective Hooks) system to synchronize PEX16 release from the ER and track its subsequent trafficking

  • Use metabolic labeling with radioisotopes or click chemistry to follow newly synthesized PEX16

Pharmacological approaches:

  • Apply drugs that disrupt specific cellular trafficking pathways (e.g., Brefeldin A for Golgi transport, nocodazole for microtubules) to determine trafficking dependencies

  • Use translation inhibitors (cycloheximide) to distinguish between newly synthesized and pre-existing pools of PEX16

Genetic manipulation strategies:

  • Generate domain-specific mutations in PEX16 to identify regions responsible for ER retention versus peroxisomal targeting

  • Create cell lines with inducible expression of wild-type or mutant PEX16 to study the dynamics of trafficking under controlled conditions

  • Knockdown or knockout key components of various trafficking pathways to determine their contribution to PEX16 movement

The experimental design should incorporate appropriate controls and consider the potentially distinct mechanisms that mediate PEX16 trafficking in different cell types or developmental stages.

  • What are the implications of PEX16 mutations in human disease models, and how can these be studied?

PEX16 mutations have significant implications in human disease, particularly in peroxisome biogenesis disorders (PBDs) such as Zellweger syndrome. Research approaches for studying these implications include:

Patient-derived cell models:

  • Fibroblasts from patients with PEX16 mutations (e.g., CG-D/CG-IX complementation group) provide valuable insights into the cellular consequences of PEX16 dysfunction

  • The homozygous nonsense mutation C→T at position 526 in codon 176Arg resulting in a termination codon (TGA) has been identified in patients, indicating the C-terminal half is essential for PEX16 function

Disease modeling approaches:

  • Generation of induced pluripotent stem cells (iPSCs) from patient fibroblasts and their differentiation into relevant cell types

  • CRISPR/Cas9-mediated introduction of patient-specific mutations into cell lines or model organisms

  • Conditional knockout models to study tissue-specific effects of PEX16 deficiency

Phenotypic analyses:

  • Peroxisome morphology and abundance using fluorescence microscopy with peroxisomal markers

  • Biochemical assays for peroxisomal metabolic functions, particularly fatty acid oxidation

  • Lipidomic analyses to characterize alterations in lipid profiles, especially very long-chain fatty acids (VLCFAs) that typically accumulate in PBDs

Therapeutic approaches:

  • Evaluation of chemical chaperones that might rescue misfolded mutant PEX16

  • Assessment of gene therapy approaches for PEX16 replacement

  • Testing of compounds that might bypass the requirement for PEX16 in peroxisome formation

Understanding the structure-function relationship of PEX16 through these disease models can provide critical insights not only into peroxisome biogenesis disorders but also into fundamental aspects of organelle biogenesis.

  • How does PEX16 contribute to adipocyte development and lipid metabolism?

PEX16 plays a crucial role in adipocyte development and lipid metabolism, with implications for metabolic health. Research has demonstrated that:

  • Stable silencing of Pex16 in 3T3-L1 cells drastically reduces peroxisome numbers while leaving mitochondrial numbers unaffected

  • PEX16 deficiency leads to:

    • Reduced peroxisomal fatty acid oxidation

    • Accumulation of long- and very long-chain (polyunsaturated) fatty acids

    • Reduction of odd-chain fatty acids

    • Decreased cellular oxygen consumption

    • Increased fatty acid release

Effects on adipogenesis:

PEX16 silencing impairs:

  • Adipocyte differentiation

  • Expression of lipogenic and adipogenic marker genes

  • Cellular triglyceride stores

Notably, the addition of PPARγ agonist rosiglitazone and peroxisome-related lipid species to Pex16-silenced 3T3-L1 cells rescues adipogenesis, suggesting that PEX16's role in adipogenesis is mediated through peroxisome-derived lipid signals that affect PPARγ activity .

Experimental approaches for studying PEX16 in adipocyte biology:

ApproachApplicationKey Measurements
Gene silencingKnockdown PEX16 in pre-adipocytesDifferentiation capacity, lipid accumulation
MetabolomicsAnalyze lipid species in PEX16-deficient cellsChanges in fatty acid profiles, especially VLCFAs and PUFAs
TranscriptomicsExamine gene expression changesAlterations in adipogenic and metabolic pathways
RespirometryMeasure cellular oxygen consumptionAssessment of mitochondrial and peroxisomal functions
Rescue experimentsAdd back specific lipids or activate specific pathwaysIdentify downstream mediators of PEX16 effects

These findings suggest that PEX16-dependent peroxisome function is essential for proper adipocyte development and lipid homeostasis, with potential implications for metabolic disorders such as obesity and diabetes.

  • What methodological approaches can resolve conflicting data on PEX16 trafficking and function across different experimental systems?

Researchers investigating PEX16 often encounter conflicting data due to species-specific differences, experimental conditions, or technical limitations. The following methodological approaches can help resolve these conflicts:

Standardized experimental conditions:

  • Use equivalent cell types across species when possible (e.g., fibroblasts)

  • Maintain consistent culture conditions, expression levels, and imaging parameters

  • Employ both endogenous and tagged versions of PEX16 to control for tagging artifacts

Cross-complementation studies:

  • Express PEX16 orthologs from different species in PEX16-deficient cells to assess functional conservation

  • For example, AtPEX16 partially complements the Ylpex16 mutant despite apparent functional differences

Advanced imaging techniques:

  • Super-resolution microscopy to visualize detailed subcellular localization

  • Live-cell imaging to track PEX16 dynamics in real-time

  • FRET or FRAP analyses to assess protein interactions and mobility

Integrative multi-omics approaches:

  • Combine proteomics, lipidomics, and transcriptomics data to build comprehensive models of PEX16 function

  • Analyze PEX16 interactomes across species to identify conserved and divergent interaction partners

Systems biology modeling:

  • Develop computational models incorporating known parameters of PEX16 function

  • Simulate different experimental conditions to predict outcomes and explain discrepancies

  • Validate model predictions with targeted experiments

Careful controls for developmental stage and tissue type:

  • Recognize that PEX16 function may vary during development

  • Account for tissue-specific differences in PEX16 localization and function

  • For example, AtPEX16 localizes to both ER and peroxisomes or to peroxisomes only depending on the tissue/cell type

By implementing these methodological approaches, researchers can better understand the true nature of PEX16 function across species and experimental systems, leading to a more unified model of peroxisome biogenesis.

  • What are the cutting-edge techniques for studying the dynamic relationship between PEX16 and the formation of pre-peroxisomes?

The study of PEX16's role in pre-peroxisome formation represents a frontier in organelle biogenesis research. Several cutting-edge techniques can provide novel insights:

Advanced microscopy approaches:

  • Correlative light and electron microscopy (CLEM) to visualize pre-peroxisomal structures with molecular specificity and ultrastructural detail

  • Lattice light-sheet microscopy for high-speed, low-phototoxicity imaging of pre-peroxisome formation in living cells

  • Super-resolution microscopy techniques (PALM, STORM, STED) to visualize PEX16 clustering and organization below the diffraction limit

Proximity labeling techniques:

  • BioID or TurboID fused to PEX16 to identify proteins in proximity during different stages of pre-peroxisome formation

  • APEX2 fusion proteins for electron microscopy visualization of PEX16-containing structures

  • Split-BioID systems to identify proteins at the interface of PEX16 and other peroxins

In vitro reconstitution systems:

  • Cell-free systems using purified components to reconstitute PEX16-mediated membrane remodeling

  • Synthetic biology approaches to build minimal peroxisome-like vesicles

  • Microfluidic platforms to study membrane dynamics in controlled environments

Optogenetic tools:

  • Light-inducible dimerization of PEX16 with other peroxins to trigger peroxisome formation

  • Optogenetic control of PEX16 localization to study spatiotemporal requirements

Quantitative image analysis:

  • Machine learning algorithms for automated detection and classification of pre-peroxisomal structures

  • Particle tracking to analyze the dynamics and fusion events of pre-peroxisomes

  • Quantitative co-localization analysis to determine the timing of recruitment of different peroxins

These techniques can help address key questions about the ER-peroxisome intermediate compartment (ERPIC) and the role of PEX16 in the formation of pre-peroxisomes, potentially resolving the "chicken-or-the-egg" dilemma surrounding PEX16 and PEX3 in peroxisome biogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.