Recombinant Human Peroxisomal membrane protein PMP34 (SLC25A17)

Shipped with Ice Packs
In Stock

Description

Cofactor Transport

SLC25A17 functions as a counter-exchange transporter for essential cofactors, operating via a pyridoxal 5'-phosphate (PLP)-sensitive mechanism :

SubstrateTransport EfficiencyMechanismKey References
Coenzyme A (CoA)HighCounter-exchange
FAD, FMNHighCounter-exchange
AMPHighCounter-exchange
NAD⁺, ADP, PAPModerate/LowCounter-exchange

This transport ensures peroxisomal β-oxidation, α-oxidation, and detoxification of branched-chain fatty acids like phytanic/pristanic acids .

Role in Phytanic Acid Degradation

  • Metabolic Deficit: SLC25A17 knockout mice on a phytol-rich diet develop hepatomegaly, liver inflammation, and elevated phytanic/pristanic acid levels, particularly in females .

  • Mechanistic Insight: Accumulation suggests impaired β-oxidation or metabolite export, likely due to deficient peroxisomal CoA or disrupted thiolytic cleavage .

SLC25A17 in HPV Infection

Genome-wide CRISPR-Cas9 screening identified SLC25A17 as critical for human papillomavirus (HPV) entry:

  • Validation: CRISPR knockout of SLC25A17 in HeLa and 293FT cells reduced HPV PsV infectivity by ~50–70%, confirmed via flow cytometry and qRT-PCR .

  • Proposed Mechanism: PMP34 may interact with viral capsid proteins or facilitate lipid synthesis required for viral replication .

Experimental ModelPhenotypeStatistical SignificanceSource
SLC25A17 KO (HeLa)70% reduction in HPV PsV infectivity*P < 0.001
SLC25A17 KO (293FT)50% reduction in HPV PsV infectivity*P < 0.001

Expression Patterns

  • Ubiquitous Expression: Detected in all human tissues, with higher levels in testis, prostate, and ovaries .

  • Downregulation: Observed in recurrent exertional rhabdomyolysis (a myopathy), suggesting links to mitochondrial dysfunction .

Disease Implications

  • Phytanic Acid Disorders: Impaired SLC25A17 function may exacerbate conditions like refsum disease (phytanic acid accumulation) .

  • HPV-Associated Cancers: Potential therapeutic target for HPV-related malignancies .

Research Tools

  • Recombinant Protein: Produced via cell-free synthesis (e.g., Nicotiana tabacum expression systems), conjugated with Strep Tags for purification .

  • Experimental Uses:

    • Western Blotting: Validates protein expression or knockout efficiency.

    • ELISA: Quantifies SLC25A17 in biological samples.

    • Topology Studies: GFP-tagged variants (e.g., GFP11-N/C-terminal tags) elucidate membrane orientation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary based on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
SLC25A17; PMP34; Peroxisomal membrane protein PMP34; 34 kDa peroxisomal membrane protein; Solute carrier family 25 member 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A17
Target Protein Sequence
MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEG LLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTT PLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPA IQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPE NRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMG LKRAHQH
Uniprot No.

Target Background

Function
Peroxisomal membrane protein PMP34 (SLC25A17) is a transporter responsible for the movement of various cofactors, including coenzyme A (CoA), flavin adenine dinucleotide (FAD), flavin mononucleotide (FMN), and nucleotide adenosine monophosphate (AMP), into peroxisomes. It also facilitates the transport of nicotinamide adenine dinucleotide (NAD+), adenosine diphosphate (ADP), and adenosine 3',5'-diphosphate (PAP) to a lesser extent. This protein is believed to mediate the transfer of free CoA, FAD, and NAD+ from the cytosol into the peroxisomal matrix through a counter-exchange mechanism. In vitro studies have shown that PMP34 is inhibited by pyridoxal 5'-phosphate and bathophenanthroline.
Gene References Into Functions
  1. PEX16 facilitates the peroxisomal trafficking of two distinct peroxisomal membrane proteins, PEX3 and PMP34, via the endoplasmic reticulum PMID: 25002403
  2. SLC25A17 serves as a transporter for CoA and FAD, as well as NAD to a lesser extent PMID: 22185573
  3. Research has identified PMP34, a peroxisomal membrane protein belonging to the mitochondrial solute carrier family, as an adenine nucleotide transporter. PMID: 12445829
Database Links

HGNC: 10987

OMIM: 606795

KEGG: hsa:10478

STRING: 9606.ENSP00000390722

UniGene: Hs.474938

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Cytoplasm. Peroxisome membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous. Expressed in liver.

Q&A

What is the basic structure of human peroxisomal membrane protein PMP34?

PMP34, encoded by the SLC25A17 gene, belongs to the mitochondrial solute carrier family. Its structural hallmark consists of three tandem-repeated modules of approximately 100 amino acids each. Each module is composed of two hydrophobic transmembrane α-helices connected by a large hydrophilic loop. This structural arrangement is characteristic of the mitochondrial carrier family proteins, though PMP34 is uniquely localized to peroxisomes rather than mitochondria . When designing experiments involving recombinant PMP34, researchers should consider these structural features to ensure proper protein folding and membrane integration.

How evolutionarily conserved is PMP34 across species?

PMP34 demonstrates remarkable evolutionary conservation, with orthologs identified across diverse taxonomic groups including mammals, amphibians, fishes, insects, nematodes, yeasts, and plants . In yeast species like C. boidinii and S. cerevisiae, the orthologs PMP47 and ANT1, respectively, facilitate β-oxidation of medium-chain fatty acids . In plants, orthologs such as PMP38 in Arabidopsis are involved in glyoxysomal β-oxidation during germination and auxin generation . This conservation suggests fundamental biological roles that have been maintained throughout evolution, making comparative studies valuable for understanding human PMP34 function.

What are effective methods for measuring PMP34 expression in research samples?

For quantitative analysis of PMP34 expression at the mRNA level, real-time PCR represents a reliable methodological approach. A validated protocol includes:

  • Initial reverse transcriptase reactions using:

    • 2 μg RNA

    • 1× first strand buffer

    • 500 ng oligo(dT)

    • 0.5 mM dNTP

    • 40 U RNase inhibitor

    • 10 mM DTT

    • 200 U SuperScript II enzyme

  • Real-time PCR reactions with:

    • 30 ng cDNA

    • Appropriate primer pairs (10-25 μM each)

    • 10 μM TaqMan FAM-TAMRA labeled probe

    • TaqMan Fast Universal PCR Master Mix

Thermal cycling parameters should include 20 minutes at 95°C, followed by 40 cycles of 3 seconds at 95°C and 30 seconds at 60°C . Expression data should be normalized to housekeeping genes such as β-actin or 18S rRNA to account for variations in input RNA quality and quantity between samples.

How can researchers develop effective knockout models to study PMP34 function?

Two complementary approaches have proven successful for generating PMP34 knockout models:

  • CRISPR-Cas9 system for cell culture models:

    • Design gRNAs targeting SLC25A17 exons

    • Validate knockout efficiency using flow cytometry for functional assays

    • Confirm reduced expression using qRT-PCR with primers normalized to ACTB

As demonstrated in validation experiments with 293FT and HeLa cells, gRNAs against SLC25A17 significantly attenuated the efficiency of HPV pseudovirion infection, confirming successful knockout .

  • Gene trap approach for animal models:

    • Northern blot analysis can confirm absence of expression in knockout mice

    • Phenotypic characterization should include both baseline conditions and challenge tests

    • In PMP34-deficient mice, no obvious phenotype was observed under normal conditions, highlighting the importance of challenge experiments with compounds like phytol to reveal functional deficits .

What cell survival assays are appropriate for studying PMP34 function in infectious disease models?

When investigating PMP34's role in viral infection pathways, researchers can employ a cell survival assay using pseudovirions with reporter systems. A validated methodology includes:

  • Inoculation of target cells (e.g., 293FT) with varying concentrations of pseudovirions (0-18 μL of 5.7 × 10^6 IU/mL)

  • Treatment with ganciclovir (10-40 μg/mL) one day post-inoculation

  • Quantification of surviving cells two days after initial inoculation

This approach, utilizing HPV pseudovirions carrying the truncated herpes simplex virus thymidine kinase (dTK), allows for selective killing of infected cells when combined with ganciclovir, providing a robust readout for infection efficiency .

How is PMP34 involved in HPV infection pathways?

Recent genome-wide CRISPR-Cas9 screening identified SLC25A17 (encoding PMP34) as a key factor in HPV infection. The experimental approach revealed:

  • Five rounds of selection using HPV pseudovirions in 293FT cells identified SLC25A17 as one of two candidate genes significantly involved in infection

  • Validation experiments showed that gRNAs targeting SLC25A17 attenuated HPV pseudovirion infection efficiency in both 293FT and HeLa cells

  • Flow cytometry analysis demonstrated significant reduction in GFP expression in cells with SLC25A17 knockdown following HPV-PsV-GFP-TK infection

While the exact mechanism remains to be elucidated, these findings suggest PMP34 may serve as a previously unrecognized component of the HPV infection pathway, potentially as a receptor or mediator of viral entry or trafficking. This research opens new avenues for understanding HPV-related cancers, including oropharyngeal cancer .

What metabolic disorders might result from PMP34 dysfunction?

PMP34 deficiency primarily affects branched-chain fatty acid metabolism. In knockout mice challenged with dietary phytol, researchers observed:

  • Hepatomegaly and liver inflammation

  • Induction of peroxisomal enzymes

  • Elevated hepatic triacylglycerols and cholesterylesters

  • Accumulation of phytanic acid and pristanic acid in liver lipids

  • Detection of pristanic acid degradation products and CoA-esters of branched fatty acids

These findings suggest PMP34 is crucial for the degradation of phytanic/pristanic acid and/or export of their metabolites. The phenotype was partially mediated by PPARα, with females showing greater accumulation of branched fatty acids than males. Interestingly, other peroxisomal functions, including bile acid formation, remained largely intact, suggesting PMP34 deficiency in humans would likely not be life-threatening but could cause elevated phytanic/pristanic acid levels, particularly in older adults .

How do peroxisomal cofactor transport mechanisms affect PMP34 function?

While PMP34 belongs to the mitochondrial solute carrier family, its precise transport substrates in human peroxisomes remain incompletely characterized. Research indicates:

Future research should employ direct measurement of peroxisomal cofactor concentrations using techniques such as targeted metabolomics of isolated peroxisomes from wild-type versus PMP34-deficient cells to resolve these questions.

What is the structural basis for substrate selectivity in PMP34?

Understanding the molecular basis for PMP34's substrate selectivity requires advanced structural biology approaches:

  • Cryo-electron microscopy of purified recombinant PMP34 can provide insights into the three-dimensional arrangement of the transmembrane helices and substrate-binding sites

  • Site-directed mutagenesis of conserved residues in the hydrophilic loops connecting transmembrane domains should identify critical amino acids involved in substrate recognition

  • In silico molecular docking studies using the solved structure can predict interactions with potential substrates including CoA derivatives and metabolic intermediates

While the structure of human PMP34 has not been fully resolved, its membership in the mitochondrial carrier family suggests structural similarity to better-characterized members like the ADP/ATP carrier, which could serve as a template for homology modeling.

How does PMP34 interact with the peroxisomal protein import machinery?

The integration of PMP34 into the peroxisomal membrane represents an important aspect of peroxisome biogenesis:

  • As a member of the peroxisomal membrane protein family, PMP34 likely requires the PEX19 pathway for proper targeting and insertion

  • In-depth analysis of potential targeting signals within PMP34's sequence can identify critical residues for peroxisomal localization

  • Proximity labeling techniques such as BioID or APEX2 fused to PMP34 can identify interacting partners during membrane insertion

Understanding these interactions could provide insights into both PMP34 function and general peroxisomal membrane protein biogenesis mechanisms.

How do the functions of PMP34 orthologs differ across species?

PMP34 orthologs demonstrate diverse functionalities across taxonomic groups:

  • In C. boidinii and S. cerevisiae, the orthologs PMP47 and ANT1 facilitate β-oxidation of medium-chain fatty acids

  • In Yarrowia lipolytica, the ortholog is essential for utilizing short chain alkanes converted to short fatty acids

  • In plants like Arabidopsis, orthologs (PMP38) are involved in glyoxysomal β-oxidation during germination and auxin generation

  • Plant peroxisomes contain additional solute transporters (PNC1 and PNC2) that function as ATP/ADP+AMP counterexchangers

This functional diversity suggests evolutionary adaptation of a common ancestral protein to meet species-specific metabolic requirements. Comparative biochemical analysis of recombinant orthologs from different species can reveal conserved and divergent transport properties, informing our understanding of human PMP34 function.

How can studies of PMP34 deficiency in model organisms inform human disease research?

The PMP34-deficient mouse model provides valuable insights for translational research:

  • The absence of an obvious phenotype under standard conditions but development of metabolic abnormalities under phytol challenge suggests:

    • Humans with PMP34 deficiency might only present symptoms under specific dietary or metabolic stress conditions

    • Diagnostic tests should include challenge protocols to reveal latent defects

  • The sex-dependent differences observed in phytanic/pristanic acid accumulation (more pronounced in females) highlights the importance of considering sex as a biological variable in both model organism studies and potential human cases

  • The lack of severe peroxisomal dysfunction despite PMP34 deficiency suggests compensatory mechanisms may exist, warranting investigation of potential therapeutic approaches that could enhance these natural compensation pathways

What expression systems are optimal for producing functional recombinant human PMP34?

Production of functional membrane proteins like PMP34 requires careful consideration of expression systems:

  • Mammalian expression systems (HEK293 or CHO cells) offer proper post-translational modifications and membrane insertion machinery

  • Insect cell systems (Sf9 or Hi5) using baculovirus vectors can produce higher yields while maintaining proper folding

  • Cell-free expression systems supplemented with lipid nanodiscs or microsomes can provide rapid production for structural studies

Key considerations for optimization include:

  • Addition of C-terminal tags (His6, FLAG) positioned to avoid interference with membrane insertion

  • Codon optimization for the chosen expression system

  • Inducible expression systems to minimize toxicity during cell growth

  • Proper detergent selection for extraction while maintaining native conformation

What are the best approaches for validating the functionality of recombinant PMP34?

Functional validation of recombinant PMP34 should incorporate multiple complementary approaches:

  • Cellular localization studies using fluorescence microscopy to confirm proper targeting to peroxisomes

  • Reconstitution into proteoliposomes for transport assays using radiolabeled substrates

  • Rescue experiments in PMP34-deficient cells to confirm restoration of:

    • HPV pseudovirion infection susceptibility

    • Phytanic/pristanic acid metabolism under challenge conditions

These functional assays are essential to ensure that the recombinant protein maintains native properties before proceeding to more specialized experimental applications.

How might targeting PMP34 contribute to novel antiviral strategies?

The identification of PMP34 as a potential factor in HPV infection opens new therapeutic possibilities:

  • Development of small molecule inhibitors targeting PMP34 could potentially block HPV entry or early infection steps

  • Screening approaches:

    • Structure-based virtual screening if crystal structure becomes available

    • High-throughput functional screening using the HPV pseudovirion system described in the literature

  • Validation of promising compounds through:

    • Cell-based infection assays with multiple HPV types

    • Assessment of effects on normal peroxisomal metabolism to evaluate potential side effects

This approach could lead to novel preventive or therapeutic interventions for HPV-related cancers, including cervical and oropharyngeal cancers.

What techniques can address the unresolved questions about PMP34's role in peroxisomal cofactor transport?

Advanced methodologies to resolve PMP34's precise role in peroxisomal metabolism include:

  • Development of peroxisome-targeted biosensors for real-time monitoring of:

    • CoA levels

    • ATP/ADP ratios

    • NAD+/NADH levels

  • Metabolic flux analysis using isotope-labeled substrates to track specific metabolic pathways in wild-type versus PMP34-deficient cells

  • Peroxisomal proteomics comparing the composition and post-translational modifications of peroxisomal proteins in the presence and absence of PMP34

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.