Recombinant Human Peroxisome assembly protein 12 (PEX12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PEX12; PAF3; Peroxisome assembly protein 12; Peroxin-12; Peroxisome assembly factor 3; PAF-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
PEX12
Target Protein Sequence
MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFD EIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFL VLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLR YILGKAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSALKKAV GGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKM KTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN
Uniprot No.

Target Background

Function
Essential for protein import into peroxisomes.
Gene References Into Functions
  1. Examination of its role in PEX5 binding of PTS1. PMID: 12456682
  2. A single missense mutation in PEX12 was identified in eight patients with neonatal adrenoleukodystrophy and infantile Refsum disease, exhibiting peroxisomal mosaicism. PMID: 15241794
  3. Identified as a highly probable candidate gene for direct sequencing in peroxisomal biogenesis disorders with mild clinical phenotypes, mosaicism, and minimally abnormal peroxisomal parameters in fibroblasts. PMID: 17534573
  4. Analysis of the relative fraction of disease-causing alleles in the coding and splice junction sequences of the PEX12 gene. PMID: 19105186
Database Links

HGNC: 8854

OMIM: 266510

KEGG: hsa:5193

STRING: 9606.ENSP00000225873

UniGene: Hs.591190

Involvement In Disease
Peroxisome biogenesis disorder complementation group 3 (PBD-CG3); Peroxisome biogenesis disorder 3A (PBD3A); Peroxisome biogenesis disorder 3B (PBD3B)
Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is PEX12 and what is its primary cellular function?

PEX12 belongs to the peroxin-12 family and functions as an essential protein for the assembly of functional peroxisomes. It serves as an integral peroxisomal membrane protein with a zinc ring domain at its carboxy terminus. The primary role of PEX12 is in the peroxisomal matrix protein import pathway, where it acts downstream of the receptor docking event .

Structurally, PEX12 spans the peroxisome membrane twice, with both its N-terminus and C-terminus extending into the cytoplasm. Its most functionally critical region is the zinc-binding domain, which mediates protein-protein interactions essential for peroxisome biogenesis .

What are the known protein interactions of PEX12?

PEX12 primarily interacts with two other peroxins through its zinc-binding domain:

  • PEX5 - The PTS1 receptor that recognizes proteins destined for peroxisomal import

  • PEX10 - Another integral peroxisomal membrane protein required for matrix protein import

These interactions have been confirmed through multiple experimental approaches including yeast two-hybrid studies, blot overlay assays, and co-immunoprecipitation experiments. The biological significance of these interactions is supported by genetic evidence showing that overexpression of either PEX5 or PEX10 can suppress certain PEX12 mutations .

What is the relationship between PEX12 defects and human disease?

Mutations in the human PEX12 gene are causally linked to Peroxisome Biogenesis Disorders in the Zellweger Syndrome Spectrum (PBD-ZSS). PEX12 mutations represent the third most common cause of PBD-ZSS, accounting for approximately 4-11% of patients with this condition .

Zellweger syndrome is a lethal neurological disorder characterized by multiple defects in peroxisome function. Clinical manifestations include severe neurological impairment, craniofacial abnormalities, and hepatic dysfunction, reflecting the critical importance of peroxisomes in human development and physiology .

What are the recommended approaches for detecting PEX12 mutations in clinical samples?

Current best practices for detecting PEX12 mutations include:

  • Sequencing and CNV (Copy Number Variation) Detection via NextGen Sequencing using targeted capture probes

  • Full coverage analysis of all coding exons plus approximately 10 bases of flanking noncoding DNA

  • Minimum coverage definition of >20X NGS reads or Sanger sequencing

What experimental systems are most effective for studying PEX12 function?

Several experimental systems have proven valuable for investigating PEX12 function:

  • Yeast models: The PEX12 ortholog was initially identified in the yeast Pichia pastoris, making yeast an excellent model system for basic functional studies.

  • Mammalian cell culture systems: Patient-derived fibroblasts with PEX12 mutations provide a disease-relevant context for functional studies. Complementation assays using wild-type PEX12 can confirm pathogenicity of novel variants.

  • Protein interaction assays: Two-hybrid systems, blot overlay assays, and co-immunoprecipitation have all been successfully employed to characterize PEX12 interactions with other peroxins.

  • Recombinant protein expression: For biochemical studies, the C-terminal domain of PEX12 (containing the zinc-binding region) can be expressed as a fusion protein with maltose-binding protein (MBP) .

How can site-directed mutagenesis of PEX12 inform our understanding of peroxisomal import mechanisms?

Site-directed mutagenesis of PEX12 has provided critical insights into peroxisome biogenesis. A particularly informative example involves the S320F missense mutation in the zinc-binding domain, which was identified in a patient with PBD. This mutation reduces the binding of PEX12 to both PEX5 and PEX10 .

When designing site-directed mutagenesis experiments:

  • Focus on conserved residues in the zinc-binding domain (C-terminal region)

  • Consider creating mutations that mimic patient variants

  • Evaluate the effects on:

    • Protein-protein interactions (particularly with PEX5 and PEX10)

    • Peroxisomal matrix protein import efficiency

    • Peroxisome morphology and abundance

The finding that overexpression of either PEX5 or PEX10 can suppress certain PEX12 mutations provides a valuable experimental approach for distinguishing between mutations that affect specific protein interactions versus those that cause general protein misfolding .

What are the challenges in expressing full-length recombinant PEX12 and how can they be addressed?

Expression of full-length recombinant PEX12 presents several challenges due to its nature as an integral membrane protein with two transmembrane domains. These challenges include:

  • Protein solubility: As a membrane protein, PEX12 has hydrophobic regions that can cause aggregation when expressed in conventional systems.

  • Proper folding: The zinc-binding domain requires proper metal coordination for correct folding and function.

  • Post-translational modifications: Any potential modifications necessary for function may be missing in heterologous expression systems.

Recommended strategies to overcome these challenges:

StrategyDescriptionAdvantagesLimitations
Domain-specific expressionExpress only the soluble domains (e.g., C-terminal zinc-binding domain)Easier expression and purificationMay not capture full functional properties
Fusion tagsUse solubility-enhancing tags (MBP, SUMO, etc.)Improves solubility and facilitates purificationMay interfere with function or structure
Membrane-mimetic systemsExpress in the presence of detergents or lipid nanodiscsMaintains native membrane environmentComplex purification procedures
Cell-free expressionUse cell-free systems with added lipids or detergentsAvoids toxicity issues in living cellsLimited scale and potentially high cost

The successful fusion of the C-terminal domain of PEX12 with MBP has been demonstrated in previous research, providing a starting point for biochemical studies .

How does PEX12 contribute to the proposed mechanism of peroxisomal matrix protein import?

Current evidence suggests that PEX12 functions downstream of the initial docking of the PEX5 receptor to the peroxisome membrane. Specifically:

  • PEX12 interacts with PEX5 via its zinc-binding domain, but this interaction is not required for initial docking of PEX5 to peroxisomes.

  • Loss of PEX12 does not reduce the association of PEX5 with peroxisomes, confirming that PEX12 is not required for receptor docking.

  • The interaction between PEX12 and PEX10 (another zinc-ring-containing peroxin) suggests they may function together in a complex.

These findings support a model where PEX12 participates in a step of matrix protein import that occurs after cargo-loaded PEX5 has docked with the peroxisomal membrane. This could involve cargo release into the peroxisome, receptor recycling, or another aspect of the import cycle .

How conserved is PEX12 across different species and what can we learn from comparative genomics?

Comparative genomics approaches have revealed:

  • PEX12 orthologs are present in diverse eukaryotes, indicating an ancient evolutionary origin of the peroxisome biogenesis machinery.

  • Sequence alignment methods such as MAFFT (particularly the einsi-mode) are effective for identifying conserved regions across species.

  • HMM (Hidden Markov Model) profiles built from multiple sequence alignments can be useful for detecting divergent orthologs that might be missed by standard BLAST searches.

  • Some species may appear to lack PEX12 orthologs due to incomplete genome information rather than true absence of the gene. For example, a PEX12 ortholog was identified in the diatom Thalassiosira pseudonana in a previous study but was absent from the UniProt database .

What experimental approaches can be used to compare PEX12 function across species?

To investigate functional conservation and divergence of PEX12 across species, researchers can employ several approaches:

  • Complementation assays: Test whether PEX12 from one species can rescue peroxisome biogenesis in cells from another species with PEX12 deficiency.

  • Domain swapping experiments: Replace specific domains of human PEX12 with corresponding domains from other species to identify functionally critical regions.

  • Comparative interaction studies: Assess whether PEX12 from different species maintains the same protein-protein interactions (e.g., with PEX5 and PEX10).

  • Structural studies: Compare folding properties and stability of the zinc-binding domain across species.

These comparative approaches can provide insights into both the core conserved functions of PEX12 and species-specific adaptations in peroxisome biogenesis.

What are the emerging technologies that could advance PEX12 research?

Several cutting-edge technologies show promise for deepening our understanding of PEX12 function:

  • CRISPR-Cas9 genome editing: Creation of precise PEX12 mutations or tagged versions of the endogenous protein for live-cell imaging and proteomics.

  • Cryo-electron microscopy: Potential structural determination of PEX12 alone or in complex with interaction partners, especially challenging for membrane proteins like PEX12.

  • Proximity labeling approaches (BioID, APEX): Identifying the complete interactome of PEX12 in its native membrane environment.

  • Single-molecule tracking: Visualizing the dynamics of PEX12 during peroxisomal matrix protein import in real-time.

  • Patient-derived iPSCs and organoids: Studying PEX12 function in more physiologically relevant models of human development and disease.

What are the most pressing unanswered questions regarding PEX12 function?

Despite significant advances, several fundamental questions about PEX12 remain unanswered:

  • What is the precise molecular mechanism by which PEX12 facilitates matrix protein import?

  • How do PEX12, PEX10, and other peroxins coordinate their activities during peroxisome biogenesis?

  • Are there additional, undiscovered functions of PEX12 beyond its role in matrix protein import?

  • What is the three-dimensional structure of PEX12, particularly its membrane-spanning regions?

  • How is PEX12 expression and function regulated in response to metabolic needs and cellular stress?

Addressing these questions will require integrated approaches combining biochemistry, cell biology, genetics, and structural biology techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.