Recombinant Human Peroxisome biogenesis factor 2 (PEX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PEX2; PAF1; PMP3; PMP35; PXMP3; RNF72; Peroxisome biogenesis factor 2; 35 kDa peroxisomal membrane protein; Peroxin-2; Peroxisomal membrane protein 3; Peroxisome assembly factor 1; PAF-1; RING finger protein 72
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
PEX2
Target Protein Sequence
MASRKENAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACL WVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTIGGRWLEERC YDLFRNHHLASFGKVKQCVNFVIGLLKLGGLINFLIFLQRGKFATLTERLLGIHSVFCKP QNICEVGFEYMNRELLWHGFAEFLIFLLPLINVQKLKAKLSSWCIPLTGAPNSDNTLATS GKECALCGEWPTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMS EVNAL
Uniprot No.

Target Background

Function
PEX2 plays a role in peroxisome biogenesis.
Gene References Into Functions

PEX2 Function and Related Research:

  1. PEX2's involvement in peroxisome autophagy during starvation. PMID: 27597759
  2. Carrier frequencies of PEX2 mutations causing severe Zellweger syndrome in Ashkenazi Jews. PMID: 23590336
  3. Impeded ischemic wound healing in mice following recombinant PEX2 injection or lentiviral PEX2 transduction. PMID: 21903356
  4. The importance of genetic screening for PEX2 and other PEX genes in children and adults with autosomal recessive cerebellar ataxia (ARCA). PMID: 21392394
  5. A point mutation causing premature termination of peroxisome assembly factor-1 as a cause of a specific syndrome. PMID: 1546315
Database Links

HGNC: 9717

OMIM: 170993

KEGG: hsa:5828

STRING: 9606.ENSP00000349543

UniGene: Hs.437966

Involvement In Disease
Peroxisome biogenesis disorder complementation group 5 (PBD-CG5); Peroxisome biogenesis disorder 5A (PBD5A); Peroxisome biogenesis disorder 5B (PBD5B)
Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is Peroxisomal Biogenesis Factor 2 (PEX2) and what are its key structural features?

PEX2 is a peroxisomal membrane protein essential for peroxisome biogenesis and matrix protein import. Structurally, PEX2 is located on chromosome 8 and contains 5 transmembrane domains and a zinc finger binding domain that is crucial for its function . The human protein has a molecular weight of approximately 12kDa in its recombinant form with an N-terminal His tag, though the native protein is larger . PEX2 is also known by several synonyms including PXMP3, PAF1, PMP35, PMP3, RNF72, Peroxin 2, Peroxisome Assembly Factor 1, Peroxisomal Membrane Protein 35kDa, and Peroxisomal Membrane Protein 3 .

What experimental models are suitable for studying PEX2 function?

Drosophila has proven to be an effective model organism for studying PEX2 function, as demonstrated by successful rescue experiments where human PEX2 reference constructs restored peroxisome formation in Drosophila Pex2 mutants . Cell culture systems derived from patients with PEX2 variants are also valuable for understanding protein function and pathology. These cellular models often display "peroxisomal mosaicism," where some cells within a culture lack peroxisomes entirely, providing insight into the variable expressivity of PEX2 mutations . When designing experiments with these models, researchers should employ true experimental designs with appropriate controls to establish causality between PEX2 variants and observed phenotypes .

How should researchers design experiments to assess PEX2 variant functionality?

When studying PEX2 variants, researchers should implement a true experimental design with both control and experimental groups. First, define clear research questions and formulate testable hypotheses about the variant's effect on peroxisome biogenesis . Identify independent variables (e.g., PEX2 variant type) and dependent variables (e.g., peroxisome formation, matrix protein import efficiency) . The experiment should include a reference/wild-type PEX2 group and mutant variant groups with randomized assignment of samples to control for extraneous variables . For instance, when expressing human PEX2 variants in model organisms like Drosophila, ensure that the genetic background is consistent across all experimental groups to isolate the effect of the PEX2 variant specifically .

What are the optimal conditions for working with recombinant PEX2 protein in vitro?

Recombinant Human PEX2 protein is typically stored in PBS buffer (pH 7.4) containing 0.01% SKL and 5% Trehalose at -20°C . To maintain protein integrity, researchers should avoid repeated freeze/thaw cycles as these can compromise protein structure and function . When designing experiments involving recombinant PEX2, it's critical to include appropriate controls such as heat-inactivated protein or irrelevant proteins of similar size and structure. For protein interaction studies, researchers should confirm results through multiple complementary techniques (e.g., co-immunoprecipitation, yeast two-hybrid, proximity ligation assays) to validate findings and control for technique-specific artifacts. Experimental protocols should maintain consistency in protein concentration, buffer conditions, and incubation parameters to ensure reproducibility.

How can researchers assess the impact of PEX2 variants on peroxisome biogenesis?

To evaluate PEX2 variant effects on peroxisome biogenesis, researchers can implement a multi-assay approach. One effective strategy is to express the reference or variant PEX2 in model systems like Drosophila Pex2 mutants and observe phenotypic rescue patterns . Immunofluorescence microscopy can be used to visualize peroxisome formation and abundance. This technique should be combined with quantitative analysis of peroxisomal matrix protein import (using markers like catalase or PTS1-containing proteins) to assess functionality. Biochemical assays measuring peroxisome-specific enzymatic activities (such as very-long-chain fatty acid oxidation) provide functional readouts of peroxisome integrity. Western blotting can evaluate protein stability and expression levels of both the PEX2 variants and other peroxins to assess potential dominant-negative effects or compensatory mechanisms.

How do different PEX2 variants correlate with disease severity in peroxisomal biogenesis disorders?

PEX2 mutations display a clear genotype-phenotype correlation in peroxisomal biogenesis disorders (PBD-ZSD). Research in Drosophila models has demonstrated an allele severity spectrum for PEX2 variants . Specifically, some missense mutations such as PEX2C247R exhibit severity equivalent to early truncation variants like PEX2R119* . The PEX2E55K variant, associated with mild PBD-ZSD clinical presentation, shows variable rescue capacity depending on the specific assay but consistently fails to fully restore peroxisome function . The most severe variants, like homozygous PEX2R119*, cause classical Zellweger syndrome with death in early infancy . This spectrum of phenotypic effects appears to correlate with the residual functional capacity of each variant, making comprehensive functional characterization essential for accurate clinical interpretation and prognosis.

What cellular phenotypes are most informative when studying PEX2 variants in patient-derived cells?

When examining PEX2 variants in patient-derived cells, several cellular phenotypes provide valuable insights. "Peroxisomal mosaicism" is a particularly informative phenomenon observed in cells with certain PEX2 variants like PEX2E55K, where peroxisome formation varies between cells within the same culture . This mosaic pattern appears related to the mild temperature sensitivity of specific PEX2 alleles and likely reflects stochastic factors within individual cells . Other informative phenotypes include alterations in peroxisome morphology, number, and size; reduced import efficiency of specific peroxisomal matrix proteins; accumulation of very-long-chain fatty acids; and changes in cellular redox status. Researchers should employ multiple assays targeting these different aspects of peroxisome function to comprehensively characterize variant effects.

How can CRISPR/Cas9 genome editing be optimized for studying PEX2 function?

CRISPR/Cas9 genome editing offers powerful approaches for PEX2 research, but requires careful experimental design. When creating knock-in models of specific PEX2 variants, researchers should design guide RNAs with minimal off-target effects and include appropriate homology-directed repair templates to ensure precise editing. The experimental design should include comprehensive validation of edited cells through sequencing, expression analysis, and functional assays . Controls must include wild-type cells, cells edited with non-targeting guides, and ideally, rescue experiments with wild-type PEX2 to confirm specificity. For functional studies, researchers should implement true experimental designs with randomization and blocking of potential confounding variables . Time-course analyses are advisable to capture both immediate and adaptive responses to PEX2 modification, as cellular compensation may mask initial phenotypes.

What are the most informative experimental approaches for resolving contradictory findings about PEX2 function across different model systems?

When confronted with contradictory results about PEX2 function across model systems, researchers should implement a systematic approach to resolve these discrepancies. First, establish a comparative experimental design that tests the conflicting hypotheses in multiple systems simultaneously under identical conditions . This should include careful control of variables such as protein expression levels, cellular context, and environmental factors like temperature that may affect temperature-sensitive variants . Meta-analysis of published data can identify patterns in contradictory findings, potentially revealing context-dependent effects. Cross-validation through orthogonal techniques helps distinguish genuine biological differences from technical artifacts. For example, if yeast and mammalian cell studies of PEX2 yield different results, researchers should examine both systems with identical methodologies while controlling for species-specific factors such as protein interaction partners or post-translational modifications.

What quality control measures are essential when working with recombinant PEX2 protein?

When working with recombinant PEX2 protein, researchers must implement rigorous quality control measures to ensure experimental reliability. First, verify protein identity through mass spectrometry and confirm purity (>90% by SDS-PAGE is standard for commercial preparations) . Assess protein folding and structural integrity through circular dichroism or thermal shift assays. For functional studies, verify that the N-terminal His tag commonly used in recombinant PEX2 does not interfere with the biological activity being measured . Endotoxin levels should be confirmed to be below 1.0 EU per 1μg (by LAL method) to prevent confounding inflammatory responses in cellular assays . Before experimental use, researchers should validate lot-to-lot consistency through functional benchmarking against previously characterized lots. Storage conditions (-20°C with minimal freeze-thaw cycles) must be strictly maintained to preserve protein integrity .

How should researchers design experiments to distinguish between direct and indirect effects of PEX2 dysfunction?

Distinguishing direct from indirect effects of PEX2 dysfunction requires carefully structured experimental designs with appropriate controls and time-course analyses. Researchers should implement acute inducible systems (such as degron-tagged PEX2 variants or temperature-sensitive alleles) to observe immediate consequences of PEX2 loss before compensatory mechanisms engage. Complementation experiments expressing wild-type PEX2 in deficient models can confirm which phenotypes are directly reversible. Epistasis analysis, where the function of potential downstream effectors is manipulated in PEX2-deficient backgrounds, helps establish causal relationships. Molecular approaches like proximity labeling (BioID/APEX) can identify the immediate molecular neighborhood of PEX2, indicating potential direct interactors. When designing these experiments, researchers must formulate clear hypotheses about direct vs. indirect effects and employ true experimental designs with appropriate controls to establish causality rather than mere correlation .

What emerging technologies hold the most promise for advancing PEX2 research?

Several cutting-edge technologies are poised to transform PEX2 research. Cryo-electron microscopy has the potential to reveal the detailed molecular structure of PEX2 within the peroxisomal membrane, including its interactions with other peroxins. Single-cell transcriptomics and proteomics can elucidate the cellular response to PEX2 dysfunction with unprecedented resolution, potentially explaining phenomena like peroxisomal mosaicism observed in cells with certain PEX2 variants . CRISPR-based screens (both knockout and activation) may uncover novel genetic modifiers of PEX2 function, while advanced imaging techniques such as super-resolution microscopy and live-cell imaging with optogenetic tools can provide dynamic views of PEX2 activity in real-time. Researchers should design experiments that leverage these technologies while maintaining rigorous experimental controls and validation strategies to capitalize on their potential for breakthrough discoveries.

How can researchers develop more predictive models for assessing novel PEX2 variants of uncertain significance?

Developing predictive models for novel PEX2 variants requires integration of multiple data types and experimental approaches. Researchers should first establish a comprehensive dataset of well-characterized PEX2 variants with known clinical outcomes through systematic functional testing in cellular and animal models . This dataset should include detailed phenotypic metrics that can be quantitatively analyzed (e.g., percentage of cells with peroxisomes, degree of matrix protein import, biochemical function). Machine learning approaches can then be applied to this dataset to identify patterns that correlate with clinical severity. The experimental design for validating these predictive models should include prospective testing of newly identified variants, with careful attention to potential confounding variables . Cross-validation across multiple model systems (e.g., yeast, Drosophila, patient-derived cells) strengthens predictive power and helps account for context-dependent effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.