Recombinant Human PH and SEC7 domain-containing protein 2 (PSD2)

Shipped with Ice Packs
In Stock

Description

Production and Validation of Recombinant PSD2

Recombinant PSD2 is produced in multiple expression systems, each offering distinct advantages:

Key Validation Methods:

  • Western Blot (WB): Antibodies like A12531 (Boster Bio) detect PSD2 at ~85 kDa in human, mouse, and rat lysates .

  • ELISA: Commercial kits (e.g., Abbexa) quantify PSD2 with a sensitivity of <0.188 ng/ml and a linear range of 0.313–20 ng/ml .

  • Functional Assays: GEF activity validated via GDP/GTP exchange measurements on Arf6 .

Role in Neuronal Development

PSD2 regulates Arf6-dependent processes in cerebellar Purkinje cells, influencing dendrite formation and synaptic plasticity. Knockout mice exhibit motor coordination deficits, underscoring its role in cerebellar function .

Endolysosomal Trafficking

PSD2 is implicated in endosomal transport pathways linked to early-onset Alzheimer’s disease (AD). Its interaction with phosphoinositides (e.g., PIP2) modulates membrane trafficking .

Challenges and Future Directions

  • Functional Heterogeneity: Full-length PSD2’s activity may differ from partial constructs (e.g., CSB-YP861115HU1) .

  • Post-Translational Modifications: Native phosphorylation sites (e.g., Thr-312) are absent in recombinant forms, limiting physiological relevance .

  • Therapeutic Potential: Targeting PSD2-Arf6 interactions could mitigate AD progression or neurodevelopmental disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
PSD2; EFA6C; PH and SEC7 domain-containing protein 2; Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6 C; Exchange factor for ARF6 C; Pleckstrin homology and SEC7 domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-771
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MEEDKLLSAVPEEGDATRDPGPEPEEEPGVRNGMASEGLNSSLCSPGHERRGTPADTEEP TKDPDVAFHGLSLGLSLTNGLALGPDLNILEDSAESRPWRAGVLAEGDNASRSLYPDAED PQLGLDGPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDGLSLTDESDSCVSFEAPL TPLIQQRARDSPEPGAGLGIGDMAFEGDMGAAGGDGELGSPLRRSISSSRSENVLSRLSL MAMPNGFHEDGPQGPGGDEDDDEEDTDKLLNSASDPSLKDGLSDSDSELSSSEGLEPGSA DPLANGCQGVSEAAHRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLT LDGALRTFLKAFPLMGETQERERVLTHFSRRYCQCNPDDSTSEDGIHTLTCALMLLNTDL HGHNIGKKMSCQQFIANLDQLNDGQDFAKDLLKTLYNSIKNEKLEWAIDEDELRKSLSEL VDDKFGTGTKKVTRILDGGNPFLDVPQALSATTYKHGVLTRKTHADMDGKRTPRGRRGWK KFYAVLKGTILYLQKDEYRPDKALSEGDLKNAIRVHHALATRASDYSKKSNVLKLKTADW RVFLFQAPSKEEMLSWILRINLVAAIFSAPAFPAAVSSMKKFCRPLLPSCTTRLCQEEQL RSHENKLRQLTAELAEHRCHPVERGIKSKEAEEYRLKEHYLTFEKSRYETYIHLLAMKIK VGSDDLERIEARLATLEGDDPSLRKTHSSPALSQGHVTGSKTTKDATGPDT
Uniprot No.

Target Background

Gene References Into Functions
  1. Studies indicate that altered brain gene expression of PADI2, ZNF385A, PSD2, and A2ML1, along with DNA methylation dysregulation, contribute to changes in brain tissue properties associated with late-life cognitive decline, independent of common neuropathological conditions. PMID: 29084334
  2. PSD2 may play a role in endolysosomal transport, a process crucial for the development of early-onset Alzheimer's disease. PMID: 28738127
Database Links

HGNC: 19092

KEGG: hsa:84249

STRING: 9606.ENSP00000274710

UniGene: Hs.21963

Protein Families
PSD family
Subcellular Location
Cell membrane; Single-pass membrane protein. Cell projection, ruffle membrane. Cleavage furrow.

Q&A

What is the basic structural composition of PH and SEC7 domain-containing proteins?

PH (Pleckstrin Homology) and SEC7 domain-containing proteins feature a characteristic multi-domain architecture that enables their regulatory functions. The PH domain consists of a β-sheet structure typically composed of seven β-strands arranged in two antiparallel sheets and capped by a C-terminal α-helix. This domain contains unique structural elements that are critical for membrane and protein interactions .

The SEC7 domain, which is composed of 10 α-helices, forms the catalytic core responsible for guanine nucleotide exchange activity. This domain features a hydrophobic groove formed by α-helices F, G, and H along with a hydrophilic loop between α-helices F and G that creates the binding interface for substrate proteins .

In PH and SEC7 domain-containing proteins, these domains are connected by a linker region that plays a crucial role in regulating the catalytic activity through allosteric mechanisms.

How do PH domains contribute to protein localization and function?

PH domains serve as critical targeting modules by binding to membrane phosphoinositides, particularly phosphatidylinositol (3,4,5)-trisphosphate (PIP₃). This interaction anchors the protein to specific membrane compartments where their enzymatic activities are required. Beyond simple membrane targeting, PH domains function as allosteric regulators that can:

  • Bind multiple ligands cooperatively, including both phospholipids and proteins

  • Undergo conformational changes upon ligand binding that influence the activity of associated catalytic domains

  • Serve as platforms for protein-protein interactions that mediate the assembly of signaling complexes

For example, in Grp1 (a cytohesin family member), the PH domain binds both PIP₃ and Arf6- GTP, triggering a domain rearrangement that relieves autoinhibition of the associated SEC7 domain .

What methodologies are most effective for studying PH-SEC7 domain interactions?

Researchers investigating the interactions between PH and SEC7 domains should employ a multi-technique approach:

TechniqueApplicationAdvantagesLimitations
X-ray crystallographyHigh-resolution structural determinationProvides atomic-level details of domain arrangementsRequires protein crystallization; captures static states
NMR spectroscopySolution-state dynamicsCan reveal conformational changes upon ligand bindingSize limitations; requires isotope labeling
Hydrogen-deuterium exchange MSConformational dynamicsMaps binding interfaces and allosteric networksLower resolution than crystallography
FRET/BiFC assaysLive-cell domain interactionsMonitors interactions in cellular contextSignal-to-noise challenges; potential interference
Site-directed mutagenesisFunctional validationTests specific residue contributionsLabor-intensive; potential structural disruption

For optimal results, begin with structural studies using X-ray crystallography or cryo-EM to establish the basic domain architecture, then progress to dynamic studies using solution-state techniques. Functional analysis using mutagenesis and cellular assays should be performed to validate structural findings .

How can researchers effectively produce and purify recombinant PH-SEC7 domain-containing proteins?

Production of high-quality recombinant PH-SEC7 domain-containing proteins requires careful optimization:

  • Expression system selection:

    • E. coli systems work well for individual domains but may struggle with full-length proteins

    • Insect cell systems (Sf9, Hi5) often yield better results for multi-domain constructs

    • Mammalian expression systems may be necessary for proteins requiring specific post-translational modifications

  • Construct design considerations:

    • Include appropriate linker sequences between domains to maintain native flexibility

    • Consider creating truncated constructs that preserve key domain interfaces

    • Introduce solubility-enhancing tags (MBP, SUMO) that can be removed post-purification

  • Purification strategy:

    • Implement a multi-step approach beginning with affinity chromatography

    • Include ion-exchange and size-exclusion steps to achieve high purity

    • Consider stability buffers containing glycerol or specific phospholipids to maintain native conformation

When pursuing structural or biochemical studies, protein quality assessment via thermal shift assays and dynamic light scattering is essential to ensure samples are monodisperse and properly folded.

How do PH domains exhibit allosteric regulation of SEC7 catalytic activity?

PH domains regulate SEC7 catalytic activity through sophisticated allosteric mechanisms that involve domain rearrangements and altered substrate accessibility:

In cytohesin family proteins (including Grp1), the PH domain positions two pseudosubstrate motifs that physically block Arf- GDP from accessing the catalytic SEC7 domain. The helix and polybasic region C-terminal to the PH domain block the switch 2 binding site of the SEC7 domain through hydrophobic interactions and salt bridges with α-helices G and H. Meanwhile, the linker between the SEC7 and PH domains blocks the Switch 1 binding site by binding to the hydrophobic pocket formed by α-helices H and G .

Allosteric regulation is triggered when PIP₃ and Arf6- GTP bind to the PH domain, inducing a substantial conformational change. This rearrangement repositions the linker, C-terminal helix, and polybasic region away from the SEC7 domain, removing the barrier for Arf- GDP binding and activating the exchange factor function .

What is the molecular basis for cooperative binding of ligands to PH domains?

The cooperative binding of multiple ligands to PH domains involves conformational changes that enhance binding affinity and specificity:

When examining PH domains in proteins like Grp1 and ASAP1, researchers have observed that initial binding of one ligand (such as a phosphoinositide) can induce structural rearrangements that create or optimize binding sites for secondary ligands (such as Arf proteins). This positive cooperativity involves:

  • Electrostatic complementarity changes upon initial ligand binding

  • Allosteric communication through the β-sheet core structure

  • Repositioning of key binding loops to accommodate secondary ligands

For example, in Grp1, PIP₃ binding to the canonical lipid-binding pocket induces subtle conformational changes that optimize the protein-binding interface for subsequent Arf6- GTP interaction. The Arf6- GTP binding interface centers on the hydrophobic triad at the switch 1-interswitch-switch 2 junction, which binds to the β sheet β1-β4-βi1-βi2 of the PH domain .

How do post-translational modifications affect the regulatory properties of PH-SEC7 domain-containing proteins?

Post-translational modifications significantly impact PH-SEC7 protein function through multiple mechanisms:

Phosphorylation events regulated by kinases such as PKC and Akt can dramatically alter protein activity and localization. In ARNO (cytohesin 2), phosphorylation exhibits complex dual allosteric effects:

  • Phosphorylation within the SEC7 domain by Akt increases exchange factor activity, although the precise molecular mechanism remains to be determined.

  • Akt also phosphorylates ARNO within the PH domain, resulting in dissociation of the N-terminal coiled-coil domain from the C-terminal region, increasing membrane association.

  • Interestingly, phosphorylation by PKC of the polybasic region, which increases activity, stabilizes the association of the N-terminal coiled-coil domain with the C-terminus of ARNO .

These findings highlight how the same modification (phosphorylation) can have different functional outcomes depending on the specific site and kinase involved. Researchers investigating these modifications should employ phospho-specific antibodies, mass spectrometry, and site-directed mutagenesis approaches to elucidate the functional consequences of specific modifications.

What are the key differences in domain organization and regulation between different PH-SEC7 domain-containing protein family members?

Different PH-SEC7 domain-containing proteins exhibit unique regulatory mechanisms despite shared domain architecture:

Protein FamilyDomain OrganizationRegulatory MechanismFunctional Specialization
Cytohesin family (Grp1, ARNO)N-terminal coiled-coil, central SEC7, C-terminal PH domainAutoinhibition via PH domain and C-terminal helix; activated by PIP₃ and Arf6- GTP bindingMembrane trafficking, cell adhesion
Brag familyN-terminal calmodulin-binding IQ motif, central SEC7, C-terminal PH domainPH domain contacts N-terminus of SEC7 domain; lipid binding causes conformational changesEndocytosis, cell migration
EFA6 familyVariable N-terminus, central SEC7, C-terminal PH and coiled-coil domainsMembrane targeting via PH domain; activity regulation through C-terminal coiled-coilActin cytoskeleton remodeling

A notable difference is observed in Brag2, where the linker between the PH and SEC7 domains forms a subdomain of the PH domain by packing against the β1, β2, and β3 strands. This linker makes direct contact with switch 1 of the substrate Arf- GDP, contributing to Arf GEF activity. The PH domain, through its C-terminal α-helix, contacts the N-terminus of the catalytic SEC7 domain and makes edge contacts with the substrate Arf .

How can researchers reconcile contradictory findings regarding the role of phosphorylation in regulating PH-SEC7 domain-containing proteins?

The literature contains several apparent contradictions regarding phosphorylation effects on PH-SEC7 proteins that require careful experimental design to resolve:

A notable example occurs in ARNO (cytohesin 2) regulation, where contradictory effects of phosphorylation have been reported:

  • Phosphomimetic mutation at the Akt phosphorylation site within the PH domain did not affect in vitro activity, despite expectations based on structural data .

  • Phosphorylation by PKC of the polybasic region increases activity yet stabilizes association of the N-terminal coiled-coil domain with the C-terminus of ARNO, which is predicted to decrease association with membranes containing substrate Arf- GDP .

To resolve these contradictions, researchers should:

  • Design experiments that distinguish between in vitro and cellular contexts

  • Compare acute versus chronic phosphorylation effects

  • Consider the role of scaffolding proteins that may be absent in reconstituted systems

  • Examine how multiple phosphorylation events might work in concert rather than individually

  • Develop biosensors that can monitor domain arrangements in real-time following phosphorylation

The conflicting data likely reflects the complex, context-dependent nature of these regulatory systems where the net effect depends on additional factors not captured in simplified experimental systems.

What technical challenges exist in studying the membrane-associated conformational dynamics of PH-SEC7 domain-containing proteins?

Investigating the conformational dynamics of PH-SEC7 domain-containing proteins at membrane interfaces presents significant technical challenges:

ChallengeImpact on ResearchPotential Solutions
Capturing transient membrane-protein interactionsDifficulty observing short-lived intermediatesTime-resolved FRET, single-molecule techniques, triggered activation systems
Replicating native membrane composition in vitroArtifacts from simplified membrane modelsLipid nanodiscs with complex compositions, giant unilamellar vesicles, supported bilayers
Simultaneous monitoring of multiple domain movementsIncomplete mechanistic understandingMulti-color FRET, integrative structural biology approaches
Low protein concentration at membranesSignal-to-noise limitationsTotal internal reflection fluorescence, super-resolution microscopy
Multiple protein conformations in equilibriumAveraging effects obscure distinct statesSingle-molecule analysis, computational sorting of conformational ensembles

A promising approach involves combining cryo-electron tomography of membrane-associated proteins with molecular dynamics simulations to bridge structural and dynamic information. Additionally, developing tension-sensitive fluorescent probes that can report on conformational changes while proteins interact with membranes may provide valuable insights into the activation mechanisms .

How might targeted modulation of PH-SEC7 domain interactions be exploited for therapeutic development?

The allosteric regulation of PH-SEC7 domain-containing proteins presents opportunities for developing highly specific therapeutic agents:

  • Small molecule approaches:

    • Design of compounds that stabilize autoinhibited conformations

    • Development of molecules that disrupt or enhance specific domain-domain interactions

    • Creation of phosphoinositide mimetics that selectively target specific PH domains

  • Protein engineering strategies:

    • Development of engineered protein domains that can bind and modulate PH-SEC7 proteins

    • Creation of conformationally constrained variants with altered regulatory properties

    • Design of biosensors to monitor drug engagement with target domains

  • Therapeutic applications:

    • Cancer: targeting dysregulated signaling pathways controlled by PH-SEC7 proteins

    • Inflammation: modulating immune cell migration and activation

    • Neurological disorders: addressing altered vesicle trafficking

Success in this area will require comprehensive structural understanding of the allosteric networks within these proteins and development of assays that can detect subtle changes in domain arrangements upon compound binding.

What emerging technologies will advance our understanding of the temporal dynamics of PH-SEC7 domain activation?

Several cutting-edge technologies are poised to revolutionize our understanding of PH-SEC7 domain temporal dynamics:

  • Optogenetic approaches:

    • Light-inducible domain interactions to trigger specific conformational changes

    • Spatiotemporal control of protein activation in precise cellular locations

    • Combining optogenetics with live-cell imaging for real-time activity monitoring

  • Advanced microscopy:

    • Lattice light-sheet microscopy for low-phototoxicity, high-speed volumetric imaging

    • Single-molecule tracking of domain movements during activation cycles

    • Super-resolution techniques to visualize nanoscale domain reorganization

  • Computational methods:

    • Enhanced sampling molecular dynamics to capture rare transition states

    • Markov state modeling to map conformational landscapes

    • Machine learning approaches to identify patterns in complex dynamic data

  • Chemical biology tools:

    • Bio-orthogonal chemistry for site-specific protein labeling

    • Proximity-dependent labeling to map transient interaction networks

    • Activity-based probes to capture active conformational states

Integration of these technologies will provide unprecedented insights into how PH-SEC7 domain-containing proteins transition between inactive and active states, the kinetics of these transitions, and how they respond to cellular signaling events .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.