Recombinant Human Phosphatidate phosphatase PPAPDC1A (PPAPDC1A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchase method or location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of that specific tag.
Synonyms
PLPP4; DPPL2; PPAPDC1; PPAPDC1A; Phospholipid phosphatase 4; Phosphatidic acid phosphatase type 2 domain-containing protein 1A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PLPP4
Target Protein Sequence
MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFL TPLAVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDG VMNSEMHCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLC AAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPLANTACHKPYVS LRVPASLKKEERPTADSAPSLPLEGITEGPV
Uniprot No.

Target Background

Function
This protein is a magnesium-independent phospholipid phosphatase with broad substrate specificity. It primarily catalyzes the conversion of diacylglycerol pyrophosphate into phosphatidate but can also act on phosphatidate and lysophosphatidate. Phospholipid phosphatases play crucial roles in both lipid synthesis and the degradation or generation of lipid-signaling molecules like diacylglycerol.
Gene References Into Functions
  1. This study investigated the clinical significance and biological roles of PLPP4 in lung carcinoma. PMID: 28851360
Database Links

HGNC: 23531

KEGG: hsa:196051

STRING: 9606.ENSP00000381302

UniGene: Hs.40479

Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed mainly to the brain, kidney and testis, and to a lesser extent the bone marrow, thymus, prostate, liver and uterus.

Q&A

What is the fundamental biochemical function of PPAPDC1A?

PPAPDC1A (Phospholipid Phosphatase 4) is an enzyme that catalyzes the dephosphorylation of phosphatidate (PA) to produce diacylglycerol (DAG) and inorganic phosphate (Pi). This reaction is critical in lipid metabolism pathways, particularly in triacylglycerol synthesis. The diacylglycerol generated in this reaction may also be channeled toward phosphatidylcholine synthesis via the Kennedy pathway, highlighting PPAPDC1A's role as a key regulator at the intersection of multiple lipid biosynthetic pathways. This enzymatic activity positions PPAPDC1A as an important control point in cellular lipid homeostasis, influencing membrane composition, signaling lipid availability, and energy storage mechanisms .

How does PPAPDC1A expression vary across different tissue types?

PPAPDC1A expression demonstrates notable tissue-specific patterns, with particular significance in epithelial tissues. Based on integrated analyses of data from The Cancer Genome Atlas (TCGA) and ArrayExpress databases, PPAPDC1A shows differential expression between normal and malignant tissues. In lung tissue specifically, comparative analysis of 340 normal lung tissues and 2032 lung cancer specimens revealed significant expression differences. The expression patterns are typically quantified using staining index (SI) scores that combine both the proportion of positive cells and staining intensity measurements. Researchers commonly stratify expression levels using median SI scores, with scores ≤4 typically defining low expression and scores ≥6 defining high expression in tissue samples .

What is known about the regulatory mechanisms controlling PPAPDC1A expression?

Research indicates that PPAPDC1A expression can be regulated by various mechanisms including transcriptional control through specific transcription factors. While not directly demonstrated for PPAPDC1A, studies of related phosphatidate phosphatases like PAH1 suggest potential regulation through zinc-responsive elements. For instance, the zinc-responsive transcription factor Zap1p has been shown to interact with upstream activating sequence zinc-responsive elements in phosphatidate phosphatase promoters, leading to induction under zinc deficiency conditions. This regulatory mechanism connects lipid metabolism to cellular micronutrient status and suggests that PPAPDC1A might be similarly regulated by specific microenvironmental conditions, potentially through conserved regulatory pathways .

What are the recommended antibodies and conditions for PPAPDC1A detection in immunohistochemistry?

For optimal immunohistochemical detection of PPAPDC1A (PLPP4), researchers have successfully employed anti-PLPP4 antibodies from Novus Biologicals (NBP2-14545) diluted 1:100 in PBS. The standard protocol involves overnight incubation at 4°C in a humidified chamber. For scoring PPAPDC1A expression, a two-parameter system is typically used: tumor cell proportion (scored 0-4 based on percentage of positive cells) and staining intensity (scored 0-3). The staining index (SI) is calculated by multiplying these parameters, yielding scores of 0, 1, 2, 3, 4, 6, 8, 9, or 12. In research cohorts, the median SI score (often around 4) is commonly used as the threshold to stratify samples into high and low expression groups. This standardized approach facilitates consistent evaluation across different studies and laboratories .

What methods are recommended for analyzing PPAPDC1A at the protein level in cellular fractions?

Western blotting represents the gold standard for PPAPDC1A protein analysis in cellular fractions. For comprehensive analysis, researchers should separate nuclear and cytoplasmic fractions using commercial fractionation kits (such as Cell Fractionation Kit from Cell Signaling Technology) according to manufacturer protocols. Whole cell lysates should be extracted using RIPA Buffer. For PPAPDC1A detection, antibodies such as Abcam's anti-PLPP4 (Cat#: ab150925) have proven effective. To ensure proper loading controls, anti-α-tubulin antibody should be used for cytoplasmic fractions, while nuclear markers like p84 (Abcam, Cat#: ab102684) should be employed for nuclear fractions. This approach allows researchers to track the subcellular localization of PPAPDC1A, which may provide insights into its functional roles in different cellular compartments and its potential interactions with other signaling proteins .

How can researchers effectively detect and validate PPAPDC1A fusion genes in cancer samples?

Detection and validation of PPAPDC1A fusion genes requires a multi-method approach. RNA sequencing represents the initial discovery platform, capable of identifying novel fusion events like TACC2-PPAPDC1A. For validation and expanded screening, targeted RNA sequencing of all exons from identified fusion genes provides a cost-effective approach. RT-PCR verification should follow, designed to amplify across fusion breakpoints. For PPAPDC1A fusions specifically, researchers should be aware that multiple distinct mRNA breakpoints may exist for the same fusion partner (as observed with TACC2-PPAPDC1A), necessitating primers designed to capture this diversity. The mean sequencing coverage should be at least 50-fold (e.g., 56.1-fold was used in studies identifying recurrent PPAPDC1A fusions). This comprehensive approach has successfully identified TACC2-PPAPDC1A as a recurrent fusion in approximately 1% (3 of 305) of diffuse gastric cancer cases .

What evidence supports PPAPDC1A's role in cancer cell proliferation and tumorigenesis?

Multiple lines of evidence implicate PPAPDC1A in cancer cell proliferation and tumorigenesis. Studies examining PPAPDC1A's impact on cell cycle regulation have identified correlations between PPAPDC1A expression and levels of cell cycle regulators including cyclins D1, A2, and B1. Immunohistochemical analyses have demonstrated significant associations between high PPAPDC1A expression and advanced clinical features in multiple cancer types. Mechanistically, PPAPDC1A appears to modulate signaling pathways critical for cell proliferation, potentially through its generation of diacylglycerol, an important second messenger. In experimental systems, manipulation of PPAPDC1A expression levels directly impacts cancer cell proliferation rates and colony-forming ability. Statistical analysis using student's t-test and one-way ANOVA has confirmed the significance of these functional effects, with p-values <0.05 considered statistically significant .

How does PPAPDC1A expression correlate with clinical outcomes in cancer patients?

PPAPDC1A expression demonstrates significant correlations with clinical outcomes across several cancer types. Kaplan-Meier survival analysis with log-rank testing has revealed that high PPAPDC1A expression is associated with poorer prognosis in certain cancers. In diffuse gastric cancer (DGC), PPAPDC1A fusions, particularly TACC2-PPAPDC1A, have been identified as recurrent genomic alterations associated with aggressive disease behavior. Patients harboring these fusions demonstrate significantly worse survival outcomes compared to those without fusions. The prognostic impact appears independent of other genomic features such as chromosomal instability and CDH1 mutations. Chi-square tests analyzing relationships between PPAPDC1A expression and clinicopathological characteristics have identified significant associations with disease stage, metastatic status, and cellular differentiation in some cancer cohorts, further supporting its role as a clinically relevant biomarker .

What are the proposed mechanisms through which PPAPDC1A influences cancer progression?

PPAPDC1A influences cancer progression through multiple proposed mechanisms. As a phosphatidate phosphatase, it likely modulates the balance between phosphatidate and diacylglycerol, affecting both membrane composition and signaling pathways. The generation of diacylglycerol by PPAPDC1A potentially activates protein kinase C signaling cascades that promote cell proliferation and migration. In fusion forms (such as TACC2-PPAPDC1A), the enzymatic activity may be dysregulated or redirected to new substrates, potentially creating novel oncogenic functions. Analysis of cellular pathways modulated by PPAPDC1A suggests potential influence on NFAT signaling, with observed effects on phosphorylation status of NFAT1. Additionally, PPAPDC1A may influence the tumor immune microenvironment, as altered phospholipid metabolism can affect immune cell function. This multifaceted influence on both cancer cell-intrinsic pathways and tumor microenvironment interactions positions PPAPDC1A as a complex regulator of cancer progression .

What specific PPAPDC1A fusion genes have been identified in human cancers?

Research using RNA sequencing approaches has identified multiple PPAPDC1A fusion genes in human cancers. The most well-characterized include TACC2-PPAPDC1A, a recurrent in-frame fusion identified in diffuse gastric cancer (DGC). This fusion was found in approximately 1% (3 of 305) of DGC cases examined through RNA sequencing and targeted RNA sequencing analyses. PVT1-PPAPDC1A has also been reported in gastric cancer cell lines, though its prevalence in primary tumors remains less characterized. These fusions typically involve the gene encoding the phosphatase domain of PPAPDC1A fused to partner genes that may contribute regulatory elements, subcellular localization signals, or dimerization domains. The identification of these fusion events provides critical insights into potential mechanisms of PPAPDC1A dysregulation in cancer and may represent a subset of patients with distinct clinical features and therapeutic vulnerabilities .

How do PPAPDC1A fusion genes affect patient prognosis compared to other genomic alterations?

PPAPDC1A fusion genes demonstrate significant prognostic implications that appear independent of other genomic alterations. In diffuse gastric cancer, patients harboring PPAPDC1A fusions show markedly worse survival outcomes. Specifically, patients with the recurrent TACC2-PPAPDC1A fusion exhibited poorer prognosis compared to those without this genomic alteration. The prognostic impact of PPAPDC1A fusions appears comparable to established poor prognostic factors such as CDH1 mutations in early-onset diffuse gastric cancer. Survival analysis using Kaplan-Meier methods with log-rank testing has quantified this impact, with patients harboring PPAPDC1A fusions showing median survival of approximately 26.9 months compared to 94.6 months for those without (HR, 2.2 [95% CI, 1.2‒4.1]). Notably, these fusions appear to define an aggressive subset (approximately 7.5%) of diffuse gastric cancers, with prognostic significance that is independent of chromosomal instability and other common mutations .

What are the functional consequences of PPAPDC1A fusions on cellular phenotypes?

PPAPDC1A fusion genes drive significant alterations in cellular phenotypes relevant to cancer progression. Functional studies of PPAPDC1A fusions (particularly in the context of gastric cancer) have demonstrated their capacity to promote migration and invasion capabilities in diffuse gastric cancer cells. The mechanistic basis appears related to the functional domains contained within these fusion proteins. For instance, a common feature of some recurrent fusions involving PPAPDC1A is the presence of the phosphatase catalytic domain, which may have altered substrate specificity or regulation when expressed in the context of fusion proteins. Experimental approaches using ectopic expression of PPAPDC1A fusions in cell culture models have verified their functional impact on cellular behavior, although specific effects on tumorigenic potential may vary depending on the cellular context and specific fusion partners. These findings highlight PPAPDC1A fusions as potential drivers of aggressive cellular phenotypes rather than merely passenger alterations .

How might PPAPDC1A interact with tumor microenvironment components?

PPAPDC1A's role in lipid metabolism positions it as a potential mediator of tumor-microenvironment interactions. As a phosphatidate phosphatase, PPAPDC1A influences membrane lipid composition, which can affect cellular interactions with the extracellular matrix and neighboring cells. Alterations in lipid signaling mediated by PPAPDC1A may influence immune cell function within the tumor microenvironment, potentially contributing to immune evasion. Analysis of recurrent tumors with genomic instability has revealed deficits in adaptive immune populations and downregulation of immune response pathways, suggesting a complex interplay between genomic alterations and immune surveillance. While direct evidence linking PPAPDC1A to specific immune modulation is limited, the enzyme's role in generating diacylglycerol (a second messenger in immune cell signaling) suggests potential mechanisms through which it could influence tumor-immune interactions. Future research should examine correlations between PPAPDC1A expression/activity and tumor-infiltrating immune populations to better understand these relationships .

What experimental approaches are recommended for studying the enzymatic activity of recombinant PPAPDC1A?

For rigorous characterization of recombinant PPAPDC1A enzymatic activity, researchers should implement a multi-faceted approach. Expression systems should include both bacterial (E. coli) and mammalian cell systems to account for potential post-translational modifications. Purification should employ affinity chromatography using tagged recombinant proteins (His-tag or GST-tag), followed by size exclusion chromatography to ensure homogeneity. Enzyme activity assays should measure phosphatidate dephosphorylation using both colorimetric phosphate release assays and direct measurement of diacylglycerol production through mass spectrometry. Kinetic parameters (Km, Vmax) should be determined using various substrate concentrations under physiologically relevant conditions. Substrate specificity studies should compare dephosphorylation rates across different phospholipid substrates. For structural insights, circular dichroism and thermal shift assays can assess protein folding and stability. Finally, inhibitor screening using focused libraries of lipid-modifying enzyme inhibitors can identify molecules for functional studies .

How might single-cell RNA sequencing approaches enhance our understanding of PPAPDC1A in heterogeneous tumor populations?

Single-cell RNA sequencing (scRNA-seq) offers transformative potential for understanding PPAPDC1A biology in heterogeneous tumor populations. This approach can reveal cell-specific expression patterns of PPAPDC1A across diverse tumor cell subpopulations, stromal components, and immune cells, providing insights into which specific cell types most strongly express this enzyme. By correlating PPAPDC1A expression with cell-type specific markers and functional gene signatures, researchers can identify potential cell state-specific roles. For fusion gene detection, scRNA-seq can determine which specific cell populations harbor PPAPDC1A fusion events, potentially revealing if these are clonal or subclonal alterations. Trajectory analysis using scRNA-seq data could further elucidate how PPAPDC1A expression changes during tumor evolution and metastatic progression. This methodology has been successfully applied to develop immune population profiles in early-stage lung adenocarcinomas and could be similarly employed to understand the relationship between PPAPDC1A expression and specific immune cell populations within the tumor microenvironment .

What considerations should researchers have when designing inhibitors targeting PPAPDC1A?

Designing effective inhibitors for PPAPDC1A requires careful consideration of multiple factors. First, researchers must address selectivity challenges, as PPAPDC1A belongs to a family of related phosphatidate phosphatases with similar catalytic mechanisms. Structure-based approaches leveraging unique structural features outside the catalytic site can enhance selectivity. Second, lipid-based inhibitors must be designed with appropriate physicochemical properties to ensure cell permeability while maintaining aqueous solubility, often requiring prodrug approaches. Third, researchers should develop robust cellular assays measuring both direct target engagement and downstream functional effects, such as altered diacylglycerol levels or phosphatidate accumulation. Fourth, evaluation of inhibitors in physiologically relevant models is essential, including 3D organoid cultures derived from cancers with known PPAPDC1A alterations. Finally, combination screening approaches should be employed to identify synergistic interactions with established therapeutic agents, particularly in cancers where PPAPDC1A fusions define specific molecular subtypes with poor prognoses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.