Recombinant Human Phosphatidylcholine:ceramide cholinephosphotransferase 2 (SGMS2)

Shipped with Ice Packs
In Stock

Description

Enzymatic Functions and Reaction Dynamics

SGMS2 catalyzes two reversible reactions regulating lipid homeostasis:

  1. Forward reaction:
    Phosphatidylcholine (PC) + Ceramide (Cer)Sphingomyelin (SM) + Diacylglycerol (DAG)\text{Phosphatidylcholine (PC) + Ceramide (Cer)} \rightarrow \text{Sphingomyelin (SM) + Diacylglycerol (DAG)}

  2. Reverse reaction:
    SM + DAGPC + Cer\text{SM + DAG} \rightarrow \text{PC + Cer}

Substrate specificity:

  • Prefers PC and phosphatidylethanolamine (PE) as phospho-headgroup donors

  • Does NOT utilize free phosphorylcholine or CDP-choline

Regulatory factors:

  • Reaction direction determined by local CER/DAG concentrations

  • Generates pro-mitogenic DAG and pro-apoptotic CER

Cancer Pathogenesis

Study FocusKey FindingsMechanism
Breast cancer metastasis High SGMS2 correlates with metastasis- ↓ Ceramide → inhibits caspase-3/PARP apoptosis pathway
  • ↑ TGF-β1 secretion → activates EMT via Smad2/Snail |
    | Lipid raft modulation | Promotes oncogenic signaling | SM enrichment stabilizes membrane platforms for growth factor receptors |

Skeletal Disorders

Calvarial doughnut lesions with bone fragility (CDL):

  • Genetic cause: Heterozygous SGMS2 variants (p.Arg50*, p.Ile62Ser, p.Met64Arg)

  • Pathogenic effects:

    • ER retention of mutant SGMS2 → disrupted SM asymmetry

    • Impaired collagen secretion and matrix mineralization

Lipidomic alterations in osteoblasts:

Lipid SpeciesΔSGMS2 vs. Wildtype
Sphingomyelin (SM)↓ 75% in null mutants
Glucosylceramide (GlcCer)↑ 400%
Dihydroceramide↑ 300-400% in pathogenic variants

Research Applications of Recombinant SGMS2

Experimental uses:

  • Drug discovery: Screening SM synthase inhibitors

  • Lipidomics: Reconstituting SM synthesis pathways

  • Structural studies: Mapping membrane topology

Critical technical notes:

  • Requires detergent solubilization for in vitro assays

  • Activity assays typically measure DAG production via TLC or mass spectrometry

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributors for specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize its development.
Synonyms
SGMS2; SMS2; Phosphatidylcholine:ceramide cholinephosphotransferase 2; Sphingomyelin synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SGMS2
Target Protein Sequence
MDIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYI QIAMPTESRNKFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY IDRVKWAFSVSEINGIILVGLWITQWLFLRYKSIVGRRFCFIIGTLYLYRCITMYVTTLP VPGMHFQCAPKLNGDSQAKVQRILRLISGGGLSITGSHILCGDFLFSGHTVTLTLTYLFI KEYSPRHFWWYHLICWLLSAAGIICILVAHEHYTIDVIIAYYITTRLFWWYHSMANEKNL KVSSQTNFLSRAWWFPIFYFFEKNVQGSIPCCFSWPLSWPPGCFKSSCKKYSRVQKIGED NEKST
Uniprot No.

Target Background

Function
Sphingomyelin synthase 2 (SMS2) is a key enzyme responsible for sphingomyelin synthesis and maintenance at the plasma membrane. It catalyzes the reversible transfer of phosphocholine between phosphatidylcholine (PC) and ceramide (CER), forming sphingomyelin (SM) and diacylglycerol (DAG) as byproducts. The reaction direction is influenced by the levels of CER and DAG in the plasma membrane. SMS2 does not utilize free phosphorylcholine or CDP-choline as donors. It can also transfer phosphoethanolamine from phosphatidylethanolamine (PE) to ceramide (CER), producing ceramide phosphoethanolamine (CPE). SMS2 regulates receptor-mediated signal transduction through mitogenic DAG, proapoptotic CER, and SM, a structural component of membrane rafts involved in signal transduction and protein sorting. It also plays a role in secretory transport by regulating the DAG pool at the Golgi apparatus and its downstream effects on protein kinase D1 (PRKD1). Additionally, SMS2 is essential for normal bone matrix mineralization.
Gene References Into Functions
  1. SMS regulates the expression and function of drug transporters P-gp and MRP2. PMID: 27394416
  2. Findings suggest that the C-terminal tails of SMSs are involved in homodimer formation, which is essential for efficient transport from the endoplasmic reticulum (ER). PMID: 27927984
  3. Activation of peroxisome proliferator-activated receptor delta (PPARdelta) may pose a potential risk of atherosclerosis by enhancing the activity of SMS2. PMID: 27278004
  4. F-actin polymerization in the region of HIV-1 membrane fusion was more pronounced in Sms2-expressing cells compared to Sms-deficient cells. PMID: 25231990
  5. SMS1 and SMS2 are capable of regulating trans-Golgi network (TGN)-mediated protein trafficking and secretion. PMID: 21980337
  6. Data indicate that the increased sphingomyelin mass was due to a rapid and highly specific activation of sphingomyelin synthases SMS1 and SMS2. PMID: 22106271
  7. Direct morphological evidence supports the pro-atherogenic capabilities of sphingomyelin synthase 2. PMID: 21235823
  8. Data demonstrate that SMS2 functions as a bifunctional enzyme with both SM and CPE synthase activity. PMID: 19454763
  9. Findings show that sphingomyelin synthases SMS1 and SMS2 are co-expressed in various cell types and function as the primary Golgi- and plasma membrane-associated SM synthases in human cervical carcinoma HeLa cells, respectively. PMID: 17449912
  10. Results indicate that both synthase (SMS)1 and 2 contribute to de novo sphingomyelin (SM) synthesis and control SM levels within cells and on the cell membrane, including the plasma membrane. PMID: 17616479
  11. SMS2 is a key factor in regulating sphingomyelin and diacylglycerol metabolism within the cell, thereby influencing apoptosis. PMID: 17982138
  12. SMS2 regulates subcellular pools of diacylglycerol-binding proteins in the Golgi apparatus. PMID: 18370930
  13. SMS2 (Sphingomyelin synthase 2) plays a significant role in de novo sphingomyelin biosynthesis and plasma membrane sphingomyelin levels. PMID: 18566297
  14. Both SMS1 and SMS2 contain two histidines and one aspartic acid, which are conserved within the lipid phosphate phosphatase superfamily. Site-directed mutagenesis of these amino acids abolished SMS activity without affecting cellular distribution. PMID: 18694848
  15. These results suggest that posttranslational palmitoylation is crucial for determining the subcellular localization of SMS2. PMID: 19233134
  16. Sphingomyelin synthase 2 is one of the key determinants for plasma and liver sphingomyelin levels in mice. PMID: 19286635

Show More

Hide All

Database Links

HGNC: 28395

OMIM: 611574

KEGG: hsa:166929

STRING: 9606.ENSP00000351981

UniGene: Hs.595423

Protein Families
Sphingomyelin synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Brain, heart, kidney, liver, muscle and stomach. Also expressed in a number of cell lines such as carcinoma HeLa cells, hepatoma Hep-G2 cells, and colon carcinoma Caco-2 cells.

Q&A

What is the primary function of SGMS2 in cellular metabolism?

SGMS2 primarily functions as a sphingomyelin synthase that contributes to sphingomyelin synthesis and homeostasis at the plasma membrane. It catalyzes the reversible transfer of the phosphocholine moiety in sphingomyelin biosynthesis, where it transfers the phosphocholine head group from phosphatidylcholine (PC) to ceramide (CER) to form sphingomyelin (SM) and diacylglycerol (DAG) as a byproduct . In the reverse reaction, it can transfer phosphocholine from SM to DAG to form PC and CER, with the direction of the reaction appearing to depend on the levels of CER and DAG in the plasma membrane . This reversible enzymatic activity positions SGMS2 as a crucial regulator of the cellular balance between these bioactive lipids, impacting various downstream signaling pathways.

How does SGMS2 differ from other sphingomyelin synthase family members?

While SGMS2 shares functional similarities with other sphingomyelin synthase family members, it has unique enzymatic properties that distinguish it. Unlike SMS1 or SMSr, SGMS2 demonstrates multiple enzymatic activities, including phosphatidylcholine-phospholipase C (PC-PLC) activity (approximately 41% of its SMS activity) and phosphatidylethanolamine-phospholipase C (PE-PLC) activity (approximately 4%) . SGMS2 also possesses ceramide phosphoethanolamine synthase (CPES) activity (approximately 46% of its SMS activity) . This multifunctional capacity makes SGMS2 a candidate for long-sought mammalian PC- and PE-PLCs, with distinct selectivity for saturated fatty acid- and/or monounsaturated fatty acid-containing PC and PE species . While both SMS1 and SGMS2 synthesize sphingomyelin, SGMS2 is primarily localized to the plasma membrane and contributes more directly to plasma membrane sphingomyelin homeostasis.

What is the subcellular localization pattern of SGMS2?

SGMS2 is primarily localized to the plasma membrane, where it contributes to sphingomyelin synthesis and homeostasis . Specifically, SGMS2 is found in detergent-insoluble fractions of the plasma membrane, suggesting its association with lipid rafts or specialized membrane microdomains . This localization is facilitated by palmitoylation at specific cysteine residues (Cys-331, Cys-332, Cys-343, and Cys-348), which plays an important role in its plasma membrane targeting . Pathogenic variants of SGMS2, such as SMS2 M64R and SMS2 I62S, can disrupt this normal localization pattern, resulting in retention of SGMS2 in the endoplasmic reticulum (ER) . This mislocalization can cause substantial changes in the lipid profile of the ER and disrupt the sphingomyelin gradient along the secretory pathway .

What multiple enzymatic activities does SGMS2 exhibit beyond sphingomyelin synthesis?

Beyond its canonical sphingomyelin synthase activity, SGMS2 exhibits remarkable multifunctionality. Research has demonstrated that human SGMS2 possesses several distinct enzymatic activities when assessed in purified systems:

  • Phosphatidylcholine-phospholipase C (PC-PLC) activity: Approximately 41% of its SMS activity

  • Phosphatidylethanolamine-phospholipase C (PE-PLC) activity: Approximately 4% of its SMS activity

  • Ceramide phosphoethanolamine synthase (CPES) activity: Approximately 46% of its SMS activity

In near-native environments when reconstituted in detergent-free proteoliposomes, SGMS2 maintained these multiple activities. Notably, when ceramide and PC were present in a 1:2 ratio (approximately 2 mol% ceramide and 4 mol% PC), the PC-PLC activity was almost equal to SMS activity . These findings establish SGMS2 as a candidate for the long-sought mammalian PC/PE-PLC with unique substrate selectivity for saturated and monounsaturated fatty acid-containing phospholipid species.

How do inhibitors and regulatory factors affect SGMS2 enzymatic activities?

SGMS2 enzymatic activities are regulated by several factors:

  • D609 inhibition: The PC-PLC/SMS inhibitor D609 inhibits all enzymatic activities of SGMS2, including SMS, PC-PLC, PE-PLC, and CPES activities .

  • Zinc inhibition: Zn²⁺ strongly inhibits all the enzymatic activities of SGMS2 .

  • Feedback regulation: Interestingly, diacylglycerol (DAG), which is a product of the SMS reaction, inhibits the SMS activity of SGMS2, suggesting a feedback control mechanism .

  • Substrate availability: The direction of the reversible reaction catalyzed by SGMS2 appears to depend on the levels of ceramide and DAG in the plasma membrane .

These regulatory mechanisms highlight the sophisticated control of SGMS2 function in cellular lipid metabolism and signaling pathways, offering potential intervention points for experimental manipulation or therapeutic targeting.

How does SGMS2 activity impact membrane organization and cholesterol homeostasis?

SGMS2 plays a critical role in membrane organization through its production of sphingomyelin, which directly affects cholesterol homeostasis and membrane microdomain formation. Sphingomyelin has a stronger affinity for cholesterol than other phospholipid classes, including phosphatidylserine (PS) . This preferential interaction impacts cholesterol behavior in both artificial and biological membranes.

In cells expressing pathogenic SGMS2 variants, the normal sphingomyelin gradient along the secretory pathway is disrupted, leading to:

  • Altered cholesterol organization in the plasma membrane

  • Increased sensitivity to cholesterol-absorbing agents like methyl-β-cyclodextrin (mβCD)

  • Reduced cell viability when exposed to mβCD compared to wildtype cells

When SGMS2-deficient cells were exposed to mβCD, they displayed substantially reduced tolerance compared to wildtype cells. Expression of functional SGMS2 restored this tolerance, while pathogenic variants (M64R or I62S) failed to render cells resistant to mβCD . These findings demonstrate that SGMS2 significantly affects cholesterol organization and stability in the plasma membrane, with implications for membrane microdomain formation and associated signaling pathways.

What are effective approaches for expressing and purifying recombinant human SGMS2?

Based on research methodologies used in recent studies, effective approaches for expressing and purifying recombinant human SGMS2 include:

  • Expression Systems:

    • Mammalian expression systems (HEK293 cells) are preferable when studying post-translational modifications like palmitoylation

    • Baculovirus-insect cell systems for higher protein yields while maintaining proper folding

    • Addition of affinity tags (His-tag, tandem Strep-tag) to facilitate purification

  • Purification Strategy:

    • Detergent solubilization using mild detergents (CHAPS, DDM, or digitonin) that preserve enzymatic activity

    • Affinity chromatography using StrepTactin columns for tagged proteins

    • Size exclusion chromatography as a polishing step to remove aggregates

    • Reconstitution in lipid vesicles (proteoliposomes) for functional studies in a near-native environment

  • Activity Preservation:

    • Inclusion of glycerol (10-15%) in storage buffers

    • Addition of specific lipids during purification to stabilize the protein

    • Maintaining optimal pH (7.2-7.4) and salt concentration throughout the purification process

These approaches have successfully yielded functional recombinant SGMS2 that retains all of its enzymatic activities, including SMS, PC-PLC, PE-PLC, and CPES activities .

What methods can accurately measure SGMS2 enzymatic activities in vitro?

Several complementary methods can be used to accurately measure the multiple enzymatic activities of SGMS2 in vitro:

  • LC-MS/MS-based Enzyme Activity Assay:

    • Allows simultaneous detection and quantification of multiple lipid species

    • Can measure SM, DAG, and CPE production using standard curves

    • Capable of detecting substrate specificity for different phospholipid species

    • Example: When measuring activities in detergent-phospholipid-ceramide mixed micelles, SMS2 showed SM-producing activity of approximately 1350 pmol/mg/min and DG-producing activity of approximately 2300 pmol/mg/min

  • Fluorescently-Tagged Lipid Reporters:

    • GFP-tagged equinatoxin II (Eqt) as a non-toxic SM reporter in live cells

    • Allows detection of SM distribution inside the secretory pathway

  • Membrane Sensitivity Assays:

    • Methyl-β-cyclodextrin (mβCD) sensitivity testing to assess cholesterol organization in membranes

    • Measures cell viability as a readout of proper SM-cholesterol interactions

  • Lipid Extraction and Analysis:

    • High-performance thin-layer chromatography (HPTLC)

    • Quantitative lipidomics through mass spectrometry

    • Analysis of membrane fractions to determine lipid composition changes

These methods provide comprehensive analysis of SGMS2's multifunctional enzymatic activities and their effects on cellular lipid profiles.

What cellular models are most suitable for studying SGMS2 function?

Several cellular models have proven effective for studying SGMS2 function, each offering distinct advantages:

  • SGMS1/SGMS2 Double Knockout Cell Lines (ΔSMS1/2):

    • Provide a clean background for reconstitution experiments

    • Allow comparison between wildtype and mutant SGMS2 variants

    • Enable assessment of specific SGMS2 contribution to sphingolipid metabolism

  • Cancer Cell Lines:

    • HeLa (cervical carcinoma), Hep-G2 (hepatoma), and Caco-2 (colon carcinoma) cells naturally express SGMS2

    • Useful for studying SGMS2's role in cancer progression

    • Particularly valuable for investigating SGMS2's involvement in the TGF-β/Smad signaling pathway and epithelial-to-mesenchymal transition (EMT)

  • Breast Cancer Models:

    • Specific relevance for studying SGMS2's role in promoting aggressive breast cancer phenotypes

    • Allow investigation of how SGMS2 suppresses apoptosis through ceramide-associated pathways

    • Enable research on SGMS2's enhancement of EMT through TGF-β/Smad signaling

  • Osteoblast Cell Lines:

    • Appropriate for studying SGMS2's role in bone matrix mineralization

    • Relevant for investigating pathogenic variants associated with bone disorders like calvarial doughnut lesions with bone fragility (CDL)

These cellular models, combined with appropriate genetic manipulation techniques (CRISPR/Cas9, siRNA, overexpression systems), provide versatile platforms for comprehensive investigation of SGMS2 function in various physiological and pathological contexts.

How do mutations in SGMS2 contribute to bone disorders?

Mutations in SGMS2 have been directly linked to rare bone disorders, particularly calvarial doughnut lesions with bone fragility (CDL) and its more severe form, calvarial doughnut lesions with bone fragility and spondylometaphyseal dysplasia (CDLSMD) . These are rare autosomal dominant bone diseases with specific clinical features:

  • CDL characteristics:

    • Low bone density

    • Distinctive X-ray translucencies of the skull (doughnut-shaped lesions in cranial bones)

    • Multiple fractures

    • Elevated serum alkaline phosphatase

    • Dental caries

    • Childhood onset of primary osteoporosis

  • CDLSMD characteristics (more severe form):

    • All features of CDL plus:

    • Neonatal onset of fractures

    • Severe short stature

    • Marked cranial sclerosis

    • Spondylometaphyseal dysplasia

At the molecular level, pathogenic SGMS2 variants such as M64R and I62S disrupt normal SGMS2 localization and function. These variants cause retention of SGMS2 in the endoplasmic reticulum (ER) rather than its normal plasma membrane localization . This mislocalization leads to:

  • Production of sphingomyelin in the wrong cellular compartment

  • Disruption of the sphingomyelin gradient along the secretory pathway

  • Substantial changes in the lipid profile of the ER

  • Accumulation of dihydrosphingomyelin in the plasma membrane

  • Altered cholesterol organization in the plasma membrane

These molecular disruptions ultimately affect bone matrix mineralization, as SGMS2 is required for normal bone development and homeostasis .

What is the role of SGMS2 in cancer progression, particularly breast cancer?

SGMS2 has been implicated in promoting an aggressive breast cancer phenotype through multiple mechanisms:

  • Promotion of Cancer Cell Proliferation:

    • SGMS2 suppresses apoptosis through ceramide-associated pathways

    • High SGMS2 expression is associated with breast cancer metastasis

  • Enhancement of Invasiveness:

    • SGMS2 promotes cancer cell invasiveness by enhancing epithelial-to-mesenchymal transition (EMT)

    • This process is mediated through activation of the TGF-β/Smad signaling pathway

  • Mechanism of TGF-β/Smad Pathway Activation:

    • SGMS2 activates the TGF-β/Smad signaling pathway primarily by increasing TGF-β1 secretion

    • This effect is likely associated with aberrant expression of sphingomyelin

    • The TGF-β/Smad signaling pathway is crucial for breast cancer progression and metastasis

  • Expression Pattern:

    • SGMS2 is expressed in various cancer cell lines including:

      • HeLa cells (cervical carcinoma)

      • Hep-G2 cells (hepatoma)

      • Caco-2 cells (colon carcinoma)

These findings suggest that SGMS2 could be a potential therapeutic target for breast cancer treatment, particularly in aggressive or metastatic cases. Inhibiting SGMS2 might help reduce cancer cell proliferation and invasiveness by modulating ceramide levels and disrupting the TGF-β/Smad signaling pathway .

How does SGMS2 influence cellular signaling pathways in disease contexts?

SGMS2 influences multiple cellular signaling pathways in disease contexts through its regulation of bioactive lipids and membrane organization:

  • Regulation of Receptor-Mediated Signal Transduction:

    • SGMS2 regulates signaling through production of:

      • Mitogenic diacylglycerol (DAG) - promoting cell proliferation

      • Proapoptotic ceramide (CER) - regulating cell death

      • Sphingomyelin (SM) - a structural component of membrane rafts

    • Membrane rafts serve as platforms for signal transduction and protein sorting

  • TGF-β/Smad Signaling Pathway in Cancer:

    • SGMS2 activates this pathway by increasing TGF-β1 secretion

    • This promotes epithelial-to-mesenchymal transition (EMT)

    • EMT is a critical process in cancer metastasis

    • Aberrant expression of SM is likely associated with this effect

  • Secretory Transport Regulation:

    • SGMS2 regulates the DAG pool at the Golgi apparatus

    • This affects downstream protein kinase D1 (PRKD1) activity

    • Impacts secretory transport processes that can be altered in disease states

  • Cholesterol-Dependent Signaling:

    • SGMS2 affects cholesterol organization in the plasma membrane

    • Pathogenic variants disrupt cholesterol-sphingomyelin interactions

    • This alters cellular responses to cholesterol-modulating agents like methyl-β-cyclodextrin

    • May impact cholesterol-dependent signaling pathways

  • Bone Matrix Mineralization:

    • SGMS2 is required for normal bone matrix mineralization

    • Disruption of SGMS2 function leads to bone disorders

    • Likely involves specific signaling pathways regulating osteoblast function

Understanding these signaling mechanisms provides insights for potential therapeutic interventions targeting SGMS2 in various disease contexts, including cancer and bone disorders.

What are the current challenges in understanding SGMS2 structure-function relationships?

Several significant challenges remain in understanding SGMS2 structure-function relationships:

  • Lack of Complete Structural Information:

    • No high-resolution crystal or cryo-EM structure of full-length SGMS2 is currently available

    • This limits understanding of how the enzyme coordinates its multiple catalytic activities

    • Structural insights would help explain how pathogenic mutations alter enzyme function

  • Complex Membrane Topology:

    • SGMS2 contains multiple transmembrane domains and is palmitoylated at specific cysteine residues (Cys-331, Cys-332, Cys-343, and Cys-348)

    • Understanding how this topology influences enzyme activity in different membrane environments remains challenging

    • Determining structural elements that direct proper localization versus mislocalization (as seen with pathogenic variants)

  • Multiple Catalytic Activities in One Enzyme:

    • The molecular basis for SGMS2's diverse enzymatic activities (SMS, PC-PLC, PE-PLC, and CPES) within a single protein remains poorly understood

    • How substrate recognition and specificity are achieved for different lipid substrates

    • Mechanistic basis for the preference for saturated and monounsaturated fatty acid-containing phospholipids

  • Reversible Reaction Mechanism:

    • The factors that determine the direction of the reversible reaction (forward: PC + Cer → SM + DAG; reverse: SM + DAG → PC + Cer) are incompletely understood

    • How cellular conditions and lipid composition influence reaction directionality

    • Regulatory mechanisms controlling enzymatic preference for synthetic versus hydrolytic reactions

Addressing these challenges through interdisciplinary approaches combining structural biology, biophysics, and cellular biochemistry would significantly advance our understanding of SGMS2 function in normal physiology and disease states.

How might SGMS2 be targeted therapeutically in disease contexts?

Based on current understanding of SGMS2 function and its role in pathological conditions, several therapeutic targeting strategies show promise:

  • Small Molecule Inhibitors:

    • Selective inhibitors of SGMS2 enzymatic activity could modulate sphingolipid metabolism

    • D609 inhibits all enzymatic activities of SGMS2 (SMS, PC-PLC, PE-PLC, and CPES) , but more selective compounds are needed

    • Structure-based drug design could yield inhibitors with improved selectivity and pharmacokinetic properties

  • Targeting Specific Enzymatic Activities:

    • Development of compounds that selectively inhibit one activity (e.g., SMS) while sparing others (e.g., PC-PLC)

    • This approach could fine-tune sphingolipid and diacylglycerol levels for specific therapeutic outcomes

    • Exploiting the finding that diacylglycerol inhibits SMS activity (feedback control) to develop allosteric modulators

  • Cancer-Specific Approaches:

    • Inhibiting SGMS2 to suppress TGF-β/Smad signaling pathway activation

    • This could reduce epithelial-to-mesenchymal transition (EMT) and cancer invasiveness

    • Targeting SGMS2 in combination with existing cancer therapies to enhance efficacy

  • Bone Disorder Treatments:

    • For calvarial doughnut lesions with bone fragility disorders caused by SGMS2 mutations

    • Pharmacological chaperones to rescue mislocalized mutant SGMS2 proteins

    • Modulating downstream effects on bone matrix mineralization

    • Gene therapy approaches to deliver functional SGMS2 to affected tissues

  • Lipid Replacement Strategies:

    • Supplementation with sphingomyelin or related lipids to bypass defective SGMS2 function

    • Targeted delivery to specific cellular compartments affected by SGMS2 dysfunction

    • Restoration of proper membrane organization and signaling platform function

These therapeutic strategies require further development and validation in appropriate disease models before advancing to clinical applications, but they represent promising directions for translational research targeting SGMS2-related pathologies.

What emerging technologies are advancing SGMS2 research methodologies?

Several cutting-edge technologies are revolutionizing SGMS2 research methodologies:

  • Advanced Structural Biology Techniques:

    • Cryo-electron microscopy for membrane protein structure determination

    • Hydrogen-deuterium exchange mass spectrometry to study protein dynamics

    • Molecular dynamics simulations to understand enzyme-lipid interactions in membrane environments

    • These approaches may help overcome challenges in obtaining structural information about SGMS2

  • High-Resolution Lipidomics:

    • Improved mass spectrometry techniques for comprehensive sphingolipid profiling

    • Imaging mass spectrometry for spatial distribution analysis of lipids in tissues and cells

    • Single-cell lipidomics to understand cellular heterogeneity in SGMS2 function

    • These methods enhance detection sensitivity and specificity for SGMS2-associated lipid changes

  • Genome Editing and Cellular Models:

    • CRISPR/Cas9-based approaches for generating precise SGMS2 mutations or knockouts

    • Patient-derived induced pluripotent stem cells (iPSCs) differentiated into relevant cell types

    • Organoid models that better recapitulate tissue architecture and function

    • These systems provide more physiologically relevant contexts for studying SGMS2 function

  • In Vivo Imaging of Sphingolipid Dynamics:

    • Fluorescent sphingolipid analogs and biosensors for real-time visualization

    • Two-photon microscopy for deeper tissue imaging of sphingolipid distribution

    • Fluorescence correlation spectroscopy to study lipid-protein interactions

    • These techniques enable temporal and spatial monitoring of SGMS2 activity in living systems

  • Computational Approaches:

    • Artificial intelligence and machine learning for predicting SGMS2-lipid interactions

    • Systems biology modeling of sphingolipid metabolism networks

    • Molecular docking and virtual screening for inhibitor discovery

    • These computational tools accelerate hypothesis generation and experimental design

The integration of these emerging technologies promises to advance our understanding of SGMS2 function, regulation, and therapeutic targeting, potentially leading to breakthroughs in treating SGMS2-associated disorders such as bone diseases and cancer.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.