Recombinant Human Phosphatidylinositide phosphatase SAC1 (SACM1L)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Phosphatidylinositide Phosphatase SAC1 (SACM1L)

Recombinant Human Phosphatidylinositide phosphatase SAC1, also known as SACM1L, is a protein encoded by the SACM1L gene in humans . It functions as a phosphoinositide phosphatase and is localized to the endoplasmic reticulum . SACM1L is the human version of the Sac1 protein found in other organisms, such as Drosophila melanogaster . The protein has a canonical amino acid length of 587 residues and a mass of 67 kilodaltons .

Gene Information

The SACM1L gene is located on chromosome 11q13.2 and is associated with several identifiers, including HGNC: 17059, OMIM: 606569, KEGG: hsa:22908, STRING: 9606.ENSP00000373713, and UniGene: Hs.156509 .

Function and Activity

SAC1 (SACM1L) is a conserved transmembrane protein present in the endoplasmic reticulum and Golgi membranes . It regulates the levels of phosphatidylinositol 4-phosphate (PI4P), a crucial phosphoinositide involved in various cellular processes . The protein can dephosphorylate PI3P, PI5P, and PI(3,5)P2 in vitro .

Role in Cellular Processes

SAC1 influences cell shape and microtubule organization . Research indicates that Sac1 is essential for normal eye development in Drosophila . The proper restriction of PI4P levels by Sac1 is crucial for normal eye development . Studies using temperature-sensitive mutants in Drosophila have demonstrated that Sac1 is vital in patterning the retinal epithelium .

Impact on Development and Disease

Given its conserved nature, SAC1 may play a role in human development and disease through the regulation of microtubule stability . Sac1 phosphatidylinositol 4-phosphate phosphatase serves as a host cell factor that regulates the assembly and release of hepatitis B virus particles .

6.1. Effects of Sac1 Mutation

In Drosophila, mutations in Sac1 lead to increased PI4P levels in vivo . Mutant retinas exhibit defects in interommatidial cell (IOC) patterning . Introducing a wild-type mCherry-Sac1 transgene [mCh-Sac1(WT)] can rescue these IOC patterning defects .

6.2. PI4P Level Analysis

Compared to wild-type, Sac1 mutant IOCs display increased accumulation of mRFP-PH-FAPP on intracellular organelles, suggesting elevated levels of PI4P . Enlarged PH-FAPP-positive puncta were observed adjacent to the cis-Golgi marker Lava lamp (Lva) in Sac1 mutants, indicating increased Golgi/TGN PI4P .

6.3. Microtubule Organization

Sac1 mutant IOCs exhibit sparse, disorganized microtubules (MTs) . These microtubules disappear when fixed on ice .

7.1. Phosphatase Activity

Wild-type Drosophila Sac1 and human SAC1 (SACM1L) exhibit comparable activity in vitro . PR Drosophila Sac1 had significantly reduced phosphatase activity compared with phosphatase dead (PD) human SAC1 .

8.1. Ommatidial Mispatterning Scores (OMS) in Drosophila Mutants

GenotypeOMS (Errors per Ommatidium)nP-value
WT0.3 ± 0.1178-
Sac1 Mutant3.3 ± 0.3278< 1 × 10−14
PI4KII0.6 ± 0.1278-
mCh-Sac1(WT) Rescue0.4 ± 0.1179-
mCh-Sac1(PR)2.7 ± 0.2479-
PI4KII Suppression0.4 ± 0.1277-

8.2. Quantification of PH-FAPP-Positive Puncta

CategoryMutant TypeNumber of PunctaP-valueSize of PunctaP-value
PH-FAPP AccumulationSac1Increased< 1 × 10−5Enlarged< 1 × 10−9
Golgi Bodies (Lva)Sac1Mild Increase< 1 × 10−3UnchangedNot Significant

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SACM1L; KIAA0851; SAC1; Phosphatidylinositol-3-phosphatase SAC1; Phosphatidylinositol-4-phosphate phosphatase; Suppressor of actin mutations 1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MATAAYEQLKLHITPEKFYVEACDDGADDVLTIDRVSTEVTLAVKKDVPPSAVTRPIFGI LGTIHLVAGNYLIVITKKIKVGEFFSHVVWKATDFDVLSYKKTMLHLTDIQLQDNKTFLA MLNHVLNVDGFYFSTTYDLTHTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQP EVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVET EQIVHYNGSKASFVQTRGSIPVFWSQRPNLKYKPLPQISKVANHMDGFQRHFDSQVIIYG KQVIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVA EMQDELSYFLVDSAGQVVANQEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHV GQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHLGLIMDGWNSMIR YYKNNFSDGFRQDSIDLFLGNYSVDELESHSPLSVPRDWKFLALPIIMVVAFSMCIICLL MAGDTWTETLAYVLFWGVASIGTFFIILYNGKDFVDAPRLVQKEKID
Uniprot No.

Target Background

Function
Phosphatidylinositide phosphatase SAC1 (also known as SACM1L) catalyzes the hydrolysis of phosphatidylinositol 4-phosphate (PtdIns(4)P). It also hydrolyzes phosphatidylinositol 3-phosphate (PtdIns(3)P) and exhibits low activity toward phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2). Its PtdIns(4)P phosphatase activity is significantly enhanced when bound to PtdIns(4)P in a 'cis' configuration within the cellular environment, compared to 'trans' configuration binding. PtdIns(4)P phosphatase activity (in the 'trans' configuration) is further enhanced by the presence of PLEKHA3.
Gene References Into Functions
  1. SAC1, along with OSBP, VAP, and PITPNB, are essential host factors for AiV replication. This machinery is recruited to RNA replication sites through interactions of VAP/OSBP/SAC1 with AiV proteins and ACBD3. PMID: 29367253
  2. ER or Golgi-localized Sac1 minimally impacts PI-4P regulation of OSBP activity or recruitment to contact sites. PMID: 28471037
  3. 14-3-3 proteins mediate Sac1 trafficking from the ER via interaction with a sorting signal and COPII. PMID: 26056309
  4. hSAC1's enzymatic function regulates accessibility of the COPI interaction motif. PMID: 14527956
  5. Sac1 plays a crucial role in mammalian Golgi membrane organization and mitotic spindle formation. PMID: 18480408
Database Links

HGNC: 17059

OMIM: 606569

KEGG: hsa:22908

STRING: 9606.ENSP00000373713

UniGene: Hs.156509

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane.
Tissue Specificity
Detected in heart, brain, lung, liver, kidney, pancreas and testis.

Q&A

What is the structural organization of SAC1/SACM1L and how does it relate to its enzymatic function?

The Sac phosphatase domain of SAC1 comprises two tightly packed subdomains: a novel N-terminal subdomain and the catalytic phosphoinositide phosphatase subdomain. Unlike other CX₅RT/S-based PI phosphatases such as PTEN or MTM, SAC1 features a distinctive large positively charged groove at the catalytic site. The most remarkable structural feature is the catalytic P-loop's conformation, where the catalytic cysteine is positioned at a significant distance from the conserved arginine that binds the releasing phosphate group .

This unique structural arrangement suggests that SAC1 requires conformational changes in the catalytic P-loop to achieve a functional arrangement of catalytic residues. The large positively charged groove likely serves as a binding site for regulatory lipids that induce these conformational changes, explaining SAC1's allosteric regulation mechanism .

What substrate specificity does recombinant SAC1/SACM1L exhibit in controlled experimental conditions?

SAC1 demonstrates a defined substrate preference hierarchy, predominantly dephosphorylating PI(5)P, PI(4)P, and PI(3)P, with significantly lower activity toward PI(3,5)P₂. Notably, SAC1 shows no measurable activity against other phosphoinositides including PI(4,5)P₂, PI(3,4)P₂, and PI(3,4,5)P₃, or against inositol polyphosphates .

Unlike many other inositol polyphosphate phosphatases, SAC1 activity is not significantly affected by divalent ions such as Mg²⁺, Ca²⁺, and Mn²⁺, making it unique in its regulation mechanism . In cellular contexts, PI(4)P represents the primary physiological substrate, which aligns with SAC1's established role in regulating PI(4)P metabolism at the ER/Golgi interface.

How does SAC1/SACM1L contribute to cellular phosphoinositide homeostasis and membrane dynamics?

SAC1 serves as a critical regulator of phosphatidylinositol 4-phosphate (PI4P) metabolism, primarily functioning at the ER/Golgi interface . Its importance is underscored by the fact that SAC1 deletion in yeast results in a spectrum of functional defects including impaired membrane trafficking, abnormal actin cytoskeleton organization, and dysregulated lipid metabolism .

Recent research has identified SAC1's crucial role at membrane contact sites, where its consumption of PI4P is proposed to drive interorganelle transfer of other cellular lipids, thereby maintaining normal lipid homeostasis within cells . This mechanism explains many of the diverse cellular functions attributed to SAC1, highlighting its central position at the interface between vesicular and non-vesicular lipid transport systems.

How is SAC1/SACM1L activity allosterically regulated by membrane lipid composition?

SAC1 exhibits a sophisticated allosteric regulation mechanism mediated by specific membrane lipids. Kinetic analyses have demonstrated that SAC1 can be activated by its own product, phosphatidylinositol (PtdIns), as well as by the anionic phospholipid phosphatidylserine (PS) .

This activation involves conformational changes in the catalytic P-loop induced by direct binding of these regulatory lipids to the large cationic catalytic groove. The allosteric nature of this activation was confirmed by observing that:

  • The R207Q mutation reduces activation without affecting substrate binding

  • Sedimentation velocity measurements confirmed that activation is not due to enzyme oligomerization

  • Activation by PS produces a sigmoidal concentration-dependent response curve

This regulatory mechanism ensures that SAC1 activity is intrinsically responsive to the lipid composition of its target membrane, providing a sophisticated means of controlling phosphoinositide metabolism based on the local membrane environment .

What experimental approaches best capture the kinetics of SAC1-mediated PI4P dephosphorylation?

For robust kinetic analysis of SAC1 activity, researchers should employ:

  • Substrate preparation options:

    • Water-soluble diC₈ PI(4)P (shorter fatty acid chains)

    • Liposome-embedded brain diC₁₆ PI(4)P for membrane-context studies

  • Reaction conditions:

    • Baseline conditions without activators

    • Varying concentrations of potential allosteric activators (PtdIns, PS)

    • Controls for enzyme oligomerization using sedimentation velocity measurements

  • Data analysis approaches:

    • Progress curves to extract initial velocities

    • Plots of initial velocity versus substrate concentration

    • Plots of initial velocity versus activator concentration

For allosteric activation studies, maintain constant PI(4)P concentration while varying potential activator concentrations. The K₀.₅ value for PtdIns activation is approximately 46 ± 5 μM, providing a reference point for experimental design .

How can contradictory findings about SAC1 localization and behavior be reconciled through experimental design?

Contradictions in SAC1 behavior can be addressed through a multifaceted experimental approach that accounts for:

  • Membrane context dependency:

    • SAC1 activity varies significantly based on membrane lipid composition

    • Experimental systems should recapitulate physiological lipid environments

  • Allosteric regulation:

    • Results obtained without consideration of allosteric activators may appear contradictory

    • Include controls with varying concentrations of PtdIns and PS

  • Conformational states:

    • The unique P-loop structure requires conformational changes for full activity

    • Structural studies should examine both inactive and activated states

  • Mutation-based analysis:

    • The R207 residue serves as an allosteric site and mutations affect activation

    • Strategic mutagenesis can help dissect contradictory functional observations

By systematically addressing these factors in experimental design, researchers can develop a unified model of SAC1 function that reconciles seemingly contradictory observations across different cellular contexts .

What are the critical considerations for expressing recombinant human SAC1/SACM1L that maintains native conformation?

When expressing recombinant human SAC1/SACM1L, researchers should carefully consider:

  • Expression system selection:

    • Eukaryotic expression systems (insect cells, mammalian cells) better preserve post-translational modifications

    • If using E. coli, co-expression with chaperones may improve folding

  • Domain architecture decisions:

    • Full-length protein contains transmembrane domains challenging for expression

    • The Sac phosphatase domain alone (residues 1-511 in yeast Sac1) can be expressed as a soluble protein

    • Consider fusion tags that enhance solubility (MBP, SUMO)

  • Buffer optimization:

    • Include stabilizing agents that mimic membrane environment

    • Consider detergents or nanodiscs for full-length protein

  • Quality control assessments:

    • Verify structural integrity through circular dichroism

    • Confirm enzymatic activity against standard substrates (PI4P)

    • Evaluate allosteric response to PtdIns and PS

Remember that the unique P-loop conformation makes SAC1 particularly sensitive to conditions that might disrupt its tertiary structure, requiring careful optimization of expression and purification protocols.

What purification strategy yields the highest specific activity for recombinant SAC1/SACM1L?

To achieve optimal specific activity for recombinant SAC1/SACM1L:

  • Initial capture:

    • Affinity chromatography using His-tag or GST-tag fusion constructs

    • Include reducing agents to protect the catalytic cysteine

  • Sequential purification:

    • Ion exchange chromatography leveraging SAC1's positive charge profile

    • Size exclusion chromatography to ensure monodispersity and remove aggregates

  • Activity preservation measures:

    • Maintain reducing environment throughout purification

    • Include glycerol (10-15%) for stability

    • Consider including PtdIns at low concentrations as a stabilizing allosteric activator

  • Quality assessment:

    • Monitor specific activity at each purification step

    • Verify monomeric state through dynamic light scattering

    • Confirm allosteric activation profile with PtdIns and PS

For kinetic studies, ensure the purified protein shows the expected allosteric response curve to validate its structural integrity. The specific activity should be determined using standardized assay conditions with diC₈ PI(4)P as substrate .

How can site-directed mutagenesis be used to investigate the allosteric regulation mechanism of SAC1/SACM1L?

Site-directed mutagenesis provides powerful insights into SAC1's allosteric regulation. Based on structural and functional analysis, researchers should target:

  • Allosteric site residues:

    • The R207 residue has been identified as crucial for allosteric regulation

    • The R207Q mutation reduces activation by PtdIns without affecting substrate binding

    • Investigate nearby residues to map the complete allosteric binding site

  • Catalytic P-loop residues:

    • Mutate residues in the unique P-loop structure to analyze conformational changes

    • Focus on residues that might facilitate communication between allosteric and catalytic sites

  • Mutation analysis approach:

    • Determine K₀.₅ values for PtdIns and PS activation for each mutant

    • Compare basal versus activated enzyme kinetics

    • Analyze structural changes using biophysical methods

Previous research has demonstrated that when fully activated by allosteric regulators like PS, SAC1 activity follows Michaelis-Menten kinetics with a hyperbolic rate curve, while partial activation or mutations in allosteric sites produce more complex kinetic profiles .

What experimental systems best model SAC1/SACM1L function at membrane contact sites?

To effectively study SAC1 function at membrane contact sites:

  • In vitro reconstitution systems:

    • Artificial membrane systems with defined composition

    • Dual-membrane systems mimicking ER-plasma membrane contacts

    • Include regulatory lipids (PtdIns, PS) at physiological concentrations

  • Cellular models:

    • Proximity labeling approaches to identify interaction partners

    • FRET-based sensors for monitoring PI4P dynamics

    • Split-GFP systems to visualize membrane contact formation

  • Advanced microscopy techniques:

    • Super-resolution microscopy to visualize SAC1 at contact sites

    • Live-cell imaging with lipid sensors to track PI4P dynamics

    • Correlative light and electron microscopy for ultrastructural context

  • Biochemical approaches:

    • In vitro lipid transfer assays using purified components

    • Analysis of how Osh proteins and other factors modulate SAC1 activity

    • Reconstitution of lipid counterflow mechanisms

Recent studies have revealed that SAC1 plays an essential role at membrane contact sites where its consumption of PI4P drives interorganelle transfer of other cellular lipids, positioning it at the interface of vesicular and non-vesicular transport .

How does SAC1/SACM1L contribute to developmental processes and what experimental models best capture these functions?

SAC1's developmental roles can be investigated through:

  • Model organism approaches:

    • SAC1 is essential for the development of multicellular organisms

    • Conditional knockout models to bypass early lethality

    • Tissue-specific expression analysis during development

  • Stem cell differentiation models:

    • Embryonic stem cell differentiation with SAC1 manipulation

    • Analysis of PI4P dynamics during differentiation processes

    • Integration with developmental signaling pathways

  • Organoid systems:

    • 3D organoid cultures with SAC1 knockdown/knockout

    • Live imaging of membrane dynamics and PI4P distribution

    • Analysis of cell fate decisions and morphogenesis

  • Developmental timing analysis:

    • Temporal control of SAC1 activity using degron systems

    • Identification of critical developmental windows

    • Integration with tissue-specific transcriptomics

Studies should focus on how SAC1's role in maintaining lipid homeostasis intersects with developmental signaling pathways, particularly those involving cell polarity, morphogenesis, and organelle biogenesis during tissue specification and differentiation.

What mass spectrometry approaches best characterize SAC1/SACM1L interactome in different cellular compartments?

For comprehensive characterization of the SAC1 interactome:

  • Proximity-dependent approaches:

    • BioID or TurboID fusions to identify compartment-specific interactors

    • APEX2-based proximity labeling for temporal resolution

    • Compartment-specific targeting of SAC1 fusions

  • Cross-linking mass spectrometry:

    • Chemical crosslinking combined with MS (XL-MS)

    • Focus on identifying dynamic interaction partners

    • Structural characterization of interaction interfaces

  • Sample preparation considerations:

    • Differential detergent solubilization for membrane proteins

    • Sequential extraction methods for compartment resolution

    • Density gradient fractionation for organelle enrichment

  • Data analysis strategies:

    • Comparative analysis across cellular compartments

    • Integration with lipid composition data

    • Network analysis to identify functional modules

This approach would help identify both stable and transient SAC1 interactors across different membrane environments, providing insight into its role at membrane contact sites and in driving interorganelle lipid transfer mechanisms .

How can advanced imaging techniques be optimized to visualize SAC1/SACM1L-dependent PI4P dynamics?

To effectively visualize SAC1-dependent PI4P dynamics:

  • Fluorescent sensor optimization:

    • PI4P-specific sensors (P4M domain, SidM-P4M)

    • Ratiometric sensors for quantitative analysis

    • Targeting sensors to specific subcellular compartments

  • Live-cell imaging approaches:

    • FRET-based sensors for dynamic range

    • Photoactivatable or photoconvertible tags for pulse-chase experiments

    • Simultaneous imaging of SAC1 and PI4P

  • Super-resolution strategies:

    • Single-molecule localization microscopy (PALM/STORM)

    • Stimulated emission depletion (STED) microscopy

    • Expansion microscopy for improved resolution

  • Analysis pipelines:

    • Automated tracking of PI4P dynamics

    • Correlation analysis with membrane contact site formation

    • Integration with lipid transfer modeling

These approaches would provide spatial and temporal resolution of how SAC1 activity shapes PI4P distribution across cellular membranes, particularly at membrane contact sites where it plays a key role in lipid homeostasis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.