Recombinant Human Phosphatidylinositol N-acetylglucosaminyltransferase subunit P (PIGP)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Human Phosphatidylinositol N-acetylglucosaminyltransferase subunit P (PIGP) is an enzyme involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis . GPI acts as a membrane anchor for many cell surface proteins and is synthesized in the endoplasmic reticulum (ER) from phosphatidylinositol (PI) . It becomes attached to proteins bearing the C-terminal GPI attachment signal sequence . Biosynthesis of GPI is initiated by the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to generate N-acetylglucosaminyl-PI (GlcNAc-PI) . This reaction is mediated by GPI-N-acetylglucosaminyltransferase (GPI-GnT) .

In mammalian cells, the enzyme consists of at least six proteins: PIG-A, PIG-H, PIG-C, GPI1, PIG-P, and DPM2 . In Saccharomyces cerevisiae, GPI-GnT has been reported to have five components: Gpi1p, Gpi2p, Gpi3p, Gpi15p, and Eri1p . The complex structure is unusual for glycosyltransferases, suggesting regulation of the biosynthetic pathway at this step . It has been reported that GPI-GnT is associated with and negatively regulated by Ras2p in S. cerevisiae . Whether an association between GPI-GnT and small GTPases such as Ras2p exists in other organisms is yet to be determined .

Function and Structure

PIGP is a component of the GPI-N-acetylglucosaminyltransferase (GPI-GnT) complex, which is essential for the biosynthesis of GPI anchors . These anchors are critical for attaching numerous proteins to the cell surface . The GPI-GnT complex, responsible for the initial step in GPI anchor biosynthesis, consists of multiple subunits, including PIG-A, PIG-H, PIG-C, GPI1, PIG-P, and DPM2 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PIGP; DCRC; DSCR5; DSCRC; NPD010; Phosphatidylinositol N-acetylglucosaminyltransferase subunit P; Down syndrome critical region protein 5; Down syndrome critical region protein C; Phosphatidylinositol-glycan biosynthesis class P protein; PIG-P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
PIGP
Target Protein Sequence
MVPRSTSLTLIVFLFHRLSKAPGKMVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFI PESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAK NQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN
Uniprot No.

Target Background

Function
This protein is a component of the glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex. It catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, initiating GPI biosynthesis.
Gene References Into Functions
  1. Mouse studies suggest this gene, located within the Down Syndrome Critical Region, is uniquely expressed in developing tongues. Its encoded protein may contribute to the tongue malformations observed in Down syndrome. PMID: 11331941
Database Links

HGNC: 3046

OMIM: 605938

KEGG: hsa:51227

STRING: 9606.ENSP00000420037

UniGene: Hs.656565

Involvement In Disease
Epileptic encephalopathy, early infantile, 55 (EIEE55)
Protein Families
PIGP family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous.

Q&A

What is the primary function of PIGP in cellular biochemistry?

PIGP functions as part of the complex that catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, which constitutes the first step of glycosylphosphatidylinositol (GPI) biosynthesis . This initial step is critical for the eventual attachment of GPI-anchored proteins (GPI-APs) to cell membranes. The PIGP subunit specifically interacts with other components of this enzymatic complex to facilitate the proper transfer reaction. The coordinated activity of this complex ensures appropriate targeting of more than 150 GPI-APs that have been identified in various biological contexts, many of which play crucial roles in CNS development and signaling .

What are the common aliases and nomenclature for PIGP in scientific literature?

PIGP is known by several aliases in scientific literature and databases, including:

  • Down syndrome critical region gene 5 (DSCR5)

  • Down syndrome critical region protein 5

  • Down syndrome critical region protein C (DSRC)

  • Phosphatidylinositol glycan anchor biosynthesis, class P

  • Phosphatidylinositol-glycan biosynthesis class P protein

  • PIG-P

The gene encoding this protein is designated by the symbols DCRC, DCRC-S, DSCR5, DSCRC, DSRC, NPD010, PIG-P, and PIGP in various databases. The UniProt ID for human PIGP is P57054, and its Entrez Gene ID is 51227 .

What are the recommended protocols for using recombinant PIGP in blocking experiments?

For blocking experiments with recombinant PIGP control fragments and corresponding antibodies (such as PA5-55464), the following protocol is recommended:

  • Calculate a 100x molar excess of the protein fragment control based on the concentration and molecular weight of the antibody.

  • Pre-incubate the antibody-protein control fragment mixture for 30 minutes at room temperature.

  • Proceed with standard immunohistochemistry/immunocytochemistry (IHC/ICC) or Western blotting (WB) protocols .

This approach allows for verification of antibody specificity by demonstrating that pre-incubation with the recombinant protein prevents antibody binding to the target in subsequent assays. Researchers should note that the recombinant PIGP is intended for research use only and not for diagnostic procedures or unauthorized resale .

How can flow cytometry be optimized to assess PIGP-related defects?

Flow cytometry represents a valuable method for detecting PIGP-related defects by measuring the expression of GPI-anchored proteins (GPI-APs) on cell surfaces. Based on clinical research:

  • Sample preparation: Isolate granulocytes from peripheral blood samples using standard density gradient centrifugation.

  • Marker selection: CD16 has been demonstrated as a valuable GPI-AP marker for detecting PIGP deficiencies .

  • Gating strategy: First gate on granulocytes based on forward and side scatter properties, then assess CD16 expression.

  • Controls: Include samples from healthy individuals as positive controls for normal GPI-AP expression levels.

  • Analysis: Quantify the reduction in GPI-AP expression compared to controls, typically reported as a percentage of normal expression .

This approach has successfully identified reduced expression of CD16 in granulocytic membranes in patients with PIGP mutations, providing a functional assessment of the impact of genetic variations on GPI biosynthesis .

What experimental designs are recommended for studying PIGP function in model systems?

Based on the PIGWEB guidelines for experimental design in research, the following principles should be applied when studying PIGP function:

  • Clear hypothesis formulation: Ensure a well-defined hypothesis is established before beginning experiments to maintain scientific integrity and prevent post-hoc hypothesis generation (HARKing) .

  • Correct identification of experimental units: Properly distinguish between experimental units (where treatments are allocated) and observational units (where measurements are made) to ensure accurate statistical analysis .

  • Power analysis for sample size determination: Conduct appropriate power analyses based on expected effect sizes to determine adequate sample numbers. For molecular studies involving PIGP, consider the critical effect size of 1.0, which is small but above the inherent noise of typical assays .

  • Implementation of blinding: Where possible, researchers should blind themselves to experimental conditions during data collection and analysis to reduce bias .

  • Appropriate statistical methods: Select statistical approaches that match the experimental design and data structure. For PIGP mutation studies, methods like benchmark dose (BMD) analysis with bootstrap confidence intervals (CIs) have been successfully applied .

Experimental Design ElementKey Recommendation
Hypothesis formulationDefine hypothesis before experimentation
Experimental unit identificationDistinguish between experimental and observational units
Sample size determinationUse power analysis with appropriate effect size
RandomizationApply blocking and randomization techniques
BlindingImplement where possible to reduce bias
Statistical analysisChoose methods appropriate to design
ReportingEnsure transparent documentation of all procedures

What is the evidence linking PIGP mutations to developmental and epileptic encephalopathies?

Multiple independent studies have established PIGP mutations as causative factors in developmental and epileptic encephalopathies. The evidence includes:

  • Family studies: Research has documented at least two independent families with children affected by early-onset epilepsy, developmental delay, and hypotonia due to homozygous mutations in PIGP .

  • Molecular confirmation: Whole-exome sequencing (WES) has identified specific pathogenic variants, including a homozygous c.384del variant and a c.456delA (p.Glu153Asnfs*34) frameshift mutation .

  • Functional validation: Flow cytometry has confirmed reduced expression of GPI-anchored proteins (specifically CD16) in patients with PIGP mutations, providing functional evidence of the pathogenicity of these variants .

  • Clinical phenotype consistency: Affected individuals consistently present with severe neurological features including infantile spasms, focal, tonic, and tonic-clonic seizures, early dyskinesia progressing to quadriplegia, and a burst suppression EEG pattern .

These findings collectively corroborate PIGP as a monogenic disease gene for developmental and epileptic encephalopathy, representing a distinct subtype of inherited GPI biosynthesis defects (GPIBDs) .

What is the clinical spectrum of PIGP-related disorders?

The clinical manifestations of PIGP-related disorders present as a spectrum with some variability even within families. Key features include:

  • Neurological manifestations:

    • Severe hypotonia progressing to quadriplegia

    • Early dyskinesia

    • Infantile spasms

    • Focal, tonic, and tonic-clonic seizures

    • Burst suppression EEG pattern

    • Profound developmental delay

  • Disease progression:

    • Early onset (typically in infancy)

    • Severe disability

    • Potential premature death (documented between ages 2-12 years in some cases)

    • Two of four affected children in one study died prematurely

  • Intrafamilial variability:

    • Despite having identical mutations, affected individuals within the same family may show some variation in clinical presentation

    • This suggests additional genetic and environmental modifying factors influence the exact clinical phenotype

The phenotype significantly overlaps with related conditions caused by mutations in genes that function in complex with PIGP, including PIGA, PIGC, PIGH, PIGQ, and PIGY .

How is diagnostic testing for PIGP deficiencies performed in clinical settings?

Diagnostic approaches for PIGP deficiencies in clinical settings involve a multi-tiered strategy:

  • Genetic testing:

    • Initially, targeted gene panels for epileptic encephalopathies (including GPI biosynthesis genes)

    • Whole-exome sequencing (WES) for comprehensive genetic analysis when targeted panels are negative

    • Confirmation of variants through Sanger sequencing

  • Flow cytometry:

    • Assessment of GPI-anchored protein expression (particularly CD16) on granulocytes

    • This serves as a functional validation of genetic findings

    • Reduced expression confirms a diagnosis of inherited GPI biosynthesis defect

  • Clinical evaluation:

    • EEG to document characteristic patterns (e.g., burst suppression)

    • Brain MRI to assess structural abnormalities

    • Detailed neurological examination

  • Family studies:

    • Testing of parents to confirm carrier status for recessive variants

    • Clinical evaluation of siblings for similar presentations

    • Genetic counseling based on findings

In case reports, gene panels initially missed PIGP mutations, highlighting the importance of comprehensive WES in cases with clinical suspicion of GPI biosynthesis defects .

How does PIGP interact with the GPI-N-acetylglucosaminyltransferase complex?

PIGP functions as an integral component of the GPI-N-acetylglucosaminyltransferase (GPI-GnT) complex, which initiates GPI biosynthesis. While the search results don't provide detailed information about PIGP's specific interactions, insights can be drawn from related subunits:

  • The GPI-GnT complex requires multiple subunits for proper functioning, including PIGA, PIGC, PIGH, PIGQ, PIGY, and PIGP .

  • Similar to how PIGY directly interacts with the catalytic subunit PIG-A to regulate GPI-GnT activity , PIGP likely has specific protein-protein interactions within the complex that are essential for proper enzymatic function.

  • The functional importance of PIGP is underscored by the observation that mutations in PIGP produce phenotypes similar to those caused by mutations in genes that act in complex with PIGP (PIGA, PIGC, PIGH, PIGQ, and PIGY) .

  • The enzymatic complex as a whole catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, representing the first critical step in the GPI biosynthesis pathway .

Future structural studies and protein interaction analyses will be essential to fully elucidate the precise role of PIGP within this complex.

What are the emerging methods for studying GPI biosynthesis defects in research models?

Research into GPI biosynthesis defects is advancing through several methodological approaches:

  • Flow cytometry-based assays:

    • Monitoring expression of multiple GPI-anchored proteins simultaneously

    • Developing standardized protocols for detection of subtle changes in GPI-AP expression

  • Genetic models:

    • The Pig-a gene mutation assay provides a system for studying somatic cell mutations

    • This methodology requires small blood volume samples, making it compatible with commonly used rodent strains

    • The approach is relatively low-cost compared to other test systems for studying somatic cell mutations

  • Regulatory applications:

    • The rodent Pig-a assay is recommended as a follow-up test to positive bacterial mutagenicity findings in regulatory safety assessment programs

    • Efforts are underway to develop an Organisation for Economic Cooperation and Development (OECD) test guideline to support regulatory safety assessments

  • Benchmark dose modeling:

    • Advanced statistical approaches including benchmark dose (BMD) modeling with bootstrap confidence intervals

    • Model averaging techniques are being applied to assess potency and data quality in studies of GPI biosynthesis genes

These methods collectively provide a foundation for more sophisticated research into the consequences of PIGP and other GPI biosynthesis gene defects.

What are the potential therapeutic strategies for PIGP-related disorders?

While the search results don't directly address therapeutic approaches for PIGP-related disorders, several potential strategies can be inferred based on the understanding of the disease mechanism:

  • Gene therapy approaches:

    • Since PIGP-related disorders represent monogenic conditions, gene replacement or correction strategies could theoretically restore normal PIGP function

    • Targeted delivery to the CNS would be crucial given the neurological manifestations

  • GPI pathway modulation:

    • Identifying compounds that could enhance residual GPI biosynthesis activity in patients with hypomorphic mutations

    • Development of small molecules that could bypass the requirement for PIGP in the GPI-GnT complex

  • Symptom management:

    • Optimization of anti-epileptic drug regimens for seizure control

    • Physical and occupational therapy interventions for motor impairments

    • Nutritional support and respiratory care for severely affected individuals

  • Biomarker development:

    • Leveraging the reduced expression of GPI-APs (such as CD16) as biomarkers to monitor disease progression and treatment response

    • Using these biomarkers in clinical trials to assess therapeutic efficacy

The development of effective therapies will require further research into the precise mechanisms by which PIGP deficiency leads to neurological dysfunction and the identification of potential points of intervention in the GPI biosynthesis pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.