Recombinant Human Phosphoinositide-interacting protein (PIRT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PIRT; Phosphoinositide-interacting protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PIRT
Target Protein Sequence
MTMETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYRKPIVIMS VGGAILLFGVVITCLAYTLKLSDKSLSILKMVGPGFLSLGLMMLVCGLVWVPIIKKKQKH RQKSNFLRSLKSFFLTR
Uniprot No.

Target Background

Function

Recombinant Human Phosphoinositide-interacting protein (PIRT) is a regulatory subunit of TRPV1, a molecular sensor for noxious heat and capsaicin. It positively regulates TRPV1 channel activity through phosphatidylinositol 4,5-bisphosphate (PIP2). PIRT binds various phosphoinositides, including PIP2, but not phosphatidylinositol (PI).

Database Links

HGNC: 37239

OMIM: 612068

KEGG: hsa:644139

STRING: 9606.ENSP00000462046

UniGene: Hs.553909

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the cellular distribution of PIRT in the nervous system?

PIRT is expressed specifically in the peripheral nervous system, with predominant expression in nociceptive neurons. Immunohistochemical studies have revealed that PIRT is present in most DRG neurons, with expression patterns indicating that it labels approximately 83.9% of all DRG neurons. Double immunofluorescence staining has shown that most, if not all, CGRP-positive (peptidergic) and IB4-positive (nonpeptidergic) neurons express PIRT. These two subtypes represent major classes of unmyelinated nociceptive C-fibers. Additionally, PIRT expression partially overlaps with NF200-positive myelinated neurons, which may include thinly myelinated nociceptive Aδ fibers .

What is the functional role of PIRT in relation to TRP channels?

PIRT functions as a regulatory subunit of TRPV1, a molecular sensor of noxious heat and capsaicin. Experimental evidence from both knockout models and heterologous expression systems has demonstrated that PIRT positively regulates TRPV1 channel activity. Studies in Pirt-deficient DRG neurons have shown significantly lower noxious heat- and capsaicin-evoked currents compared to wild-type neurons. Consistently, co-expression of PIRT and TRPV1 in HEK293 cells significantly enhances TRPV1-mediated currents . This regulatory function positions PIRT as an important modulator of nociceptive signaling.

How does PIRT interact with phosphoinositides?

PIRT, as its name suggests (Phosphoinositide-Interacting Regulator of TRP), interacts with phosphoinositides, which are critical signaling lipids in cellular membranes. While the exact binding mechanisms remain under investigation, PIRT likely contains specific binding domains that recognize phosphoinositides such as phosphatidylinositol 3,4,5-trisphosphate and phosphatidylinositol 3,4-bisphosphate. This interaction appears to be essential for its function in modulating TRP channel activity, potentially by facilitating channel-lipid interactions or altering channel conformation in response to lipid binding .

What are the molecular mechanisms by which PIRT enhances TRPV1 activity?

The enhancement of TRPV1 activity by PIRT appears to involve multiple molecular mechanisms. First, PIRT may directly bind to TRPV1 through specific protein-protein interactions. Research using GST fusion constructs has been employed to identify the TRPV1-binding sites in the intracellular regions of PIRT . Second, PIRT's interaction with phosphoinositides may create a local lipid environment that favors TRPV1 activation or sensitization. Third, PIRT might influence the trafficking or membrane localization of TRPV1 channels. Finally, PIRT could potentially alter the conformational changes that TRPV1 undergoes during gating in response to stimuli like heat or capsaicin. Electrophysiological studies comparing TRPV1 currents in the presence and absence of PIRT have been instrumental in elucidating these mechanisms .

How do Pirt knockout models compare with TRPV1 knockout models in pain research?

Studies have revealed that Pirt null (Pirt⁻/⁻) mice exhibit phenotypes that resemble those observed in TRPV1⁻/⁻ mice, though the effects are less severe. This suggests that while PIRT is an important modulator of TRPV1 function, it is not absolutely required for all TRPV1-mediated responses. The specific differences in phenotypes between these two knockout models provide insights into the extent of functional coupling between PIRT and TRPV1 across different sensory modalities. Comparative analyses of these models have been valuable for understanding the relative contributions of PIRT to various aspects of nociception and pain signaling .

What experimental approaches can be used to study PIRT's interaction with phosphoinositides in relation to TRP channel modulation?

Several experimental approaches can be employed to study PIRT's interaction with phosphoinositides:

  • Lipid binding assays: Using purified recombinant PIRT protein to measure direct binding to various phosphoinositide species.

  • Tertiary recruitment approach: A method that incorporates primary recruitment of target proteins in intact cells to membranes selectively enriched in specific phosphoinositides like PtdIns(3,4)P₂, followed by secondary purification and identification by liquid chromatography-tandem MS .

  • Stable isotope labeling with amino acids in cell culture (SILAC): This approach provides a ratio-metric readout that distinguishes authentically responsive components from copurifying background proteins, useful for identifying proteins that respond to phosphoinositide signaling .

  • Electrophysiology in heterologous expression systems: Comparing TRPV1 currents in the presence of wild-type PIRT versus PIRT mutants with altered phosphoinositide binding capabilities.

  • Structural studies: Techniques like X-ray crystallography or cryo-electron microscopy to determine the molecular details of PIRT-phosphoinositide interactions.

How can recombinant PIRT protein be efficiently produced and purified for structural and functional studies?

Production of high-quality recombinant PIRT protein can be achieved through several expression systems:

Cell-free protein synthesis (CFPS): This approach has been successfully used to produce human PIRT protein (amino acids 1-137) with a Strep tag. The ALiCE® expression system, based on a lysate obtained from Nicotiana tabacum, contains all the protein expression machinery needed for proper folding and potential post-translational modifications .

Purification protocol:

  • Design and synthesize the gene encoding PIRT (amino acids 1-137)

  • Clone into an appropriate expression vector with a Strep tag

  • Express using cell-free protein synthesis

  • Purify using one-step affinity chromatography

  • Verify protein integrity using SDS-PAGE and Western blotting

This approach yields soluble protein suitable for various applications including ELISA, SDS-PAGE, and Western blotting. For functional studies, additional validation of proper folding and activity may be necessary .

What experimental strategies can be employed to characterize PIRT expression patterns in different neuronal populations?

Several complementary approaches can be used to characterize PIRT expression patterns:

In situ hybridization: Using PIRT-specific riboprobes to detect mRNA expression in tissue sections, providing cellular resolution of expression patterns.

Immunohistochemistry: Using specific antibodies against PIRT to visualize protein localization, which can be combined with markers for different neuronal populations.

Double immunofluorescence staining: This technique has revealed that PIRT is expressed in both peptidergic (CGRP+) and nonpeptidergic (IB4+) neurons, representing unmyelinated nociceptive C-fibers. It has also shown partial overlap with NF200+ myelinated neurons .

Single-cell RNA sequencing: This advanced technique can provide comprehensive expression profiles at single-cell resolution, allowing for identification of PIRT expression across diverse neuronal subtypes.

Reporter gene approaches: Generating transgenic mice where a reporter gene (e.g., GFP) is expressed under the control of the PIRT promoter to visualize expression patterns in vivo.

How can the functional interaction between PIRT and TRPV1 be assessed experimentally?

The functional interaction between PIRT and TRPV1 can be assessed through several experimental approaches:

Electrophysiological recordings: Comparing TRPV1-mediated currents in:

  • Wild-type vs. Pirt-deficient DRG neurons

  • HEK293 cells expressing TRPV1 alone vs. TRPV1+PIRT

GST fusion constructs: Creating fusion constructs with different regions of PIRT to identify specific TRPV1-binding domains .

Co-immunoprecipitation: Determining physical interaction between PIRT and TRPV1 in native tissues or heterologous expression systems.

FRET/BRET assays: Measuring proximity between fluorescently or bioluminescently tagged PIRT and TRPV1 proteins in living cells.

Calcium imaging: Assessing TRPV1-mediated calcium influx in response to capsaicin or heat in the presence or absence of PIRT.

Behavioral assays: Comparing nociceptive responses to TRPV1 agonists in wild-type vs. Pirt knockout animals.

What control experiments are essential when studying PIRT function in heterologous expression systems?

When studying PIRT function in heterologous expression systems such as HEK293 cells, several essential controls should be included:

  • Expression level verification: Western blot or immunocytochemistry to confirm comparable expression levels of TRPV1 across experimental conditions.

  • Subcellular localization assessment: Immunocytochemistry to verify proper membrane targeting of both PIRT and TRPV1.

  • Empty vector controls: Cells transfected with empty vector instead of PIRT to control for non-specific effects of the transfection procedure.

  • Dose-response relationships: Testing multiple concentrations of agonists (e.g., capsaicin) to fully characterize the modulatory effect of PIRT on TRPV1 function.

  • Mutant PIRT controls: Including non-functional PIRT mutants to confirm specificity of observed effects.

  • Phosphoinositide manipulation: Including conditions where phosphoinositide levels are altered to assess the dependence of PIRT effects on these lipids .

How should researchers address potential discrepancies between in vitro and in vivo findings regarding PIRT function?

Addressing discrepancies between in vitro and in vivo findings regarding PIRT function requires a systematic approach:

  • Context-dependent interactions: Consider that PIRT may interact with different partners in complex tissues versus simplified cell systems.

  • Complementary methodologies: Employ multiple approaches (electrophysiology, imaging, behavioral tests) to triangulate findings.

  • Physiological relevance: Ensure in vitro conditions mimic physiological parameters (temperature, pH, ionic composition) as closely as possible.

  • Genetic background effects: Consider the influence of genetic background in knockout models by using appropriate controls and multiple mouse strains.

  • Developmental compensation: Address potential compensatory mechanisms in knockout models by using conditional or inducible knockout approaches.

  • Translation to human biology: Validate findings in human tissues or cells whenever possible to ensure relevance across species .

What are the therapeutic implications of targeting PIRT for pain management?

Given PIRT's role as a positive regulator of TRPV1, a key sensor involved in nociception, it represents a potential therapeutic target for pain management. Several aspects warrant consideration:

  • Selective modulation: Targeting PIRT-TRPV1 interactions might provide more selective modulation of pain pathways than direct TRPV1 antagonism, potentially reducing side effects like hyperthermia that have hampered TRPV1 antagonist development.

  • Cell-type specificity: PIRT's restricted expression in the PNS, predominantly in nociceptive neurons, could enable selective targeting of pain signaling without affecting TRPV1 function in other tissues.

  • Modality-specific effects: Understanding how PIRT differentially affects various modalities of TRPV1 activation (heat, capsaicin, protons, endovanilloids) could lead to treatments tailored to specific pain conditions.

  • Phosphoinositide pathways: Targeting PIRT-phosphoinositide interactions might offer an alternative approach to modulate nociceptor excitability in pathological pain states .

How might the study of PIRT contribute to our understanding of other phosphoinositide-binding proteins in neuronal function?

The study of PIRT as a phosphoinositide-binding protein in neuronal function has broader implications:

  • Identification of novel domains: Analysis of PIRT may reveal new structural motifs for phosphoinositide binding, potentially applicable to other proteins. For instance, IQ motif containing GAP1, identified in screens for phosphoinositide-binding proteins, lacks known lipid interacting components and may exemplify a novel class of atypical phosphoinositide (aPI) binding domain .

  • Screening methodologies: The tertiary approach used to identify phosphoinositide-binding proteins, incorporating cellular recruitment, purification, and SILAC, provides a template for discovering other lipid-responsive proteins .

  • Regulatory mechanisms: Understanding how PIRT's phosphoinositide binding regulates ion channel function may illuminate similar mechanisms for other channels and receptors.

  • Cell-specific signaling: PIRT's restricted expression pattern highlights how phosphoinositide signaling can be tailored to specific cell types and functions, a principle likely applicable to other neuronal contexts.

  • Methodological advances: Techniques optimized for studying PIRT-phosphoinositide interactions can be applied to investigate other phosphoinositide-binding proteins in neurons .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.