Recombinant Human Phospholemman (FXYD1)

Shipped with Ice Packs
In Stock

Description

Definition and Primary Functions

FXYD1, also known as phospholemman (PLM), belongs to the FXYD family of ion transport regulators. It is a 72-amino acid protein with a conserved PFXYD domain and is expressed predominantly in the heart, skeletal muscle, and brain . Its primary function involves binding to Na⁺/K⁺-ATPase, reducing its activity under basal conditions. Phosphorylation at specific residues (e.g., Ser63, Ser68) by kinases like PKA and PKC reverses this inhibition, enhancing pump activity .

Transmembrane Topology

FXYD1 adopts a four-helix structure:

  • H1 (Extracellular): Asp12–Gln17

  • H2 (Transmembrane): Ile19–Leu36

  • H3 and H4 (Cytoplasmic): Ser37–Lys43 and Thr59–Ser68
    The flexible cytoplasmic loop (H3–H4) facilitates kinase interactions.

Phosphorylation Sites and Kinase Interactions

FXYD1 is phosphorylated at:

SiteKinaseFunctional Effect
Ser63PKC (α/ε isoforms)Inhibits Na⁺/K⁺-ATPase binding
Ser68PKARelieves inhibition of Na⁺/K⁺-ATPase
Thr69PKC (α/ε isoforms)Transient modulation during PKC activation

Phosphorylation status varies by tissue:

  • Cardiac Myocytes: ~30% basal phosphorylation at Ser63/Ser68; transient Thr69 phosphorylation during PKC activation .

  • Brain: Region-specific expression (higher in cerebellum vs. frontal cortex) and epigenetic regulation via DNA methylation .

Recombinant Production and Purification

Recombinant FXYD1 is typically expressed in bacterial (e.g., E. coli) or mammalian systems. Key purification steps include:

  1. Affinity Chromatography: Utilizes fusion tags (e.g., His-tag) for high-purity recovery .

  2. Reconstitution: Purified FXYD1 is incorporated into lipid vesicles or membrane proteins for functional assays .

Role in Ion Transport Regulation

FXYD1’s interaction with Na⁺/K⁺-ATPase isoforms (α1β1 and α2β1) reduces pump activity by 24% (α1β1) and alters kinetic parameters :

Parameterα1β1 (Control)α1β1 + FXYD1
Turnover Rate (min⁻¹)8,163 ± 2846,248 ± 115
EP (nmol/mg protein)4.42 ± 0.234.31 ± 0.15

Knockout Models and Pathophysiology

In Fxyd1-null mice:

  • Cardiac Hypertrophy: Increased cardiac mass and myocyte size .

  • Enhanced Contractility: 9% higher ejection fraction despite reduced Na⁺/K⁺-ATPase activity .

  • Isoform-Specific Effects: α2-isoform expression drops by 60%, suggesting compensatory mechanisms .

Epigenetic Regulation

DNA methylation inversely correlates with FXYD1 expression during development:

  • Brain: Increased methylation at Fxyd1a promoter in frontal cortex vs. cerebellum .

  • Heart: Decreased methylation during development, linked to higher FXYD1 expression in cardiac tissue .

Kinetic Effects and Molecular Mechanisms

Phosphorylation mimetics (e.g., S63E, S68E mutants) restore Na⁺/K⁺-ATPase activity to near-normal levels, confirming the role of phosphorylation in modulating FXYD1 function . PKC activation transiently phosphorylates Thr69, further fine-tuning pump activity in response to cellular stress .

Clinical and Therapeutic Implications

  1. Cardiovascular Disease: Altered FXYD1 expression in heart failure may serve as a biomarker or therapeutic target .

  2. Neurological Disorders: Epigenetic dysregulation of Fxyd1 in Rett syndrome highlights its role in neuronal excitability and dendritic spine formation .

  3. Drug Development: Modulators of FXYD1 phosphorylation could enhance Na⁺/K⁺-ATPase activity in conditions like arrhythmias or fatigue-related muscle disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development accordingly.
Synonyms
FXYD1; PLM; Phospholemman; FXYD domain-containing ion transport regulator 1; Sodium/potassium-transporting ATPase subunit FXYD1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-92
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
ESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
Uniprot No.

Target Background

Function
Phospholemman (FXYD1) is a regulatory protein that interacts with and modulates the activity of the sodium/potassium-transporting ATPase (NKA). NKA transports sodium ions (Na+) out of the cell and potassium ions (K+) into the cell. FXYD1 inhibits NKA activity in its unphosphorylated state, while stimulating activity when phosphorylated. It also reduces glutathionylation of the NKA beta-1 subunit ATP1B1, thus reversing glutathionylation-mediated inhibition of ATP1B1. FXYD1 contributes to female sexual development by maintaining the excitability of neurons that secrete gonadotropin-releasing hormone.
Gene References Into Functions
  1. A study revealed that the expression of FXYD1, FXYD3, and FXYD5 is elevated in the lungs of patients with Acute respiratory distress syndrome. PMID: 26410457
  2. A period of high-intensity training with reduced training volume increases expression and phosphorylation levels of FXYD1, potentially affecting Na(+)/K(+) pump activity and muscle K(+) homeostasis during intense exercise. PMID: 26791827
  3. Stopped-flow experiments using the dye RH421 demonstrated that FXYD1 slows the conformational transition E2(2K)ATP --> E1(3Na)ATP but does not affect 3NaE1P --> E2P3Na. PMID: 26429909
  4. The evolutionary conservation of G-quadruplex forming sequences was confirmed by in vitro studies demonstrating G-quadruplex formation in two FXYD1 homologues. PMID: 25051342
  5. Phospholemman undergoes various post-translational modifications that dynamically alter the activity of the Na pump. [Review] PMID: 23672825
  6. PLM regulates crucial ion transporters in the heart, making it a promising target for developing drugs to treat heart failure. PMID: 23224879
  7. Intracellular trafficking of FXYD1 (phospholemman) and FXYD7 proteins has been studied in Xenopus oocytes and mammalian cells. PMID: 22535957
  8. The severity of the spinal cord lesion significantly impacts the expression of Na(+)-K(+)-ATPase and its regulatory protein PLM. PMID: 22275761
  9. In left ventricular myocardium from patients with heart failure, PLM Ser-68 phosphorylation was approximately 50% lower than in nonfailing controls. PMID: 21849407
  10. Exercise induces FXYD1 phosphorylation at multiple sites in human muscle. In mice, contraction-induced changes in FXYD1 phosphorylation exhibit fiber-type specificity and dependence on protein kinase Calpha activity. PMID: 21957166
  11. FXYD1 enhances the affinity of the human alpha1beta1 isoform of Na,K-ATPase for Na ions. PMID: 21449573
  12. Research suggests that the PLM cytoplasmic domain exists in a dynamic equilibrium between NKA-associated and membrane-associated states, and phosphorylation potentially alters the position of this equilibrium. PMID: 21130070
  13. Phosphorylation of PLM increases its oligomerization into tetramers, decreases its binding to NKA, and alters the structures of both the tetramer and NKA regulatory complex. PMID: 21220422
  14. Phosphorylation of PLM at either Ser63 or Ser68 is both necessary and sufficient for completely relieving the PLM-induced NKA inhibition. PMID: 20861470
  15. Data indicate that phospholemman plays a significant role in fine-tuning the gating kinetics of cardiac calcium channels, likely contributing to shaping the cardiac action potential and regulating Ca(2+) dynamics in the heart. PMID: 20720179
  16. Phospholemman modulates the gating of cardiac L-type calcium channels. PMID: 20371314
  17. A study reveals the specific expression of FXYD1 in various human tissues, potentially associating with Na, K-ATPase in selected cell types and modulating its catalytic properties. PMID: 19879113
  18. Molecular cloning, protein expression, sequencing, and NMR structure determination have been conducted on FXYD1. PMID: 12535606
  19. NMR spectroscopy studies in micelles have shown that the helical regions and connecting segments of FXYD1, FXYD3, and FXYD4 coincide with the positions of intron-exon junctions in the genes. PMID: 16288923
  20. PLM interacts with the intracellular loop of NCX1, most likely at residues 218-358. PMID: 16921169
  21. A study reports that FXYD1 is elevated in frontal cortex neurons of Rett syndrome patients and Mecp2-null mice. FXYD1 is identified as a MeCP2 target gene, and its de-repression may directly contribute to RTT neuronal pathogenesis. PMID: 17309881
  22. The structure of FXYD1 suggests a mechanism whereby phosphorylation of conserved Ser residues, by protein kinases A and C, could induce a conformational change in the cytoplasmic domain, modulating its interaction with the Na,K-ATPase, alpha subunit. PMID: 18000745
  23. Reconstituted FXYD1 provides strong protection against thermal inactivation for both alpha1beta1 and alpha2beta1 isoforms of Na,K-ATPase. PMID: 18052210
  24. Data demonstrate that PLM associates with and modulates both NKA-alpha1 and NKA-alpha2 in a comparable but not identical manner. PMID: 19638348

Show More

Hide All

Database Links

HGNC: 4025

OMIM: 602359

KEGG: hsa:5348

STRING: 9606.ENSP00000343314

UniGene: Hs.442498

Protein Families
FXYD family
Subcellular Location
Cell membrane, sarcolemma; Single-pass type I membrane protein. Apical cell membrane; Single-pass type I membrane protein. Membrane, caveola. Cell membrane, sarcolemma, T-tubule.
Tissue Specificity
Highest expression in skeletal muscle and heart. Moderate levels in brain, placenta, lung, liver, pancreas, uterus, bladder, prostate, small intestine and colon with mucosal lining. Very low levels in kidney, colon and small intestine without mucosa, pros

Q&A

What is the molecular structure of human phospholemman (FXYD1)?

Phospholemman (FXYD1) is a 72-amino acid transmembrane protein predominantly expressed in cardiac sarcolemma and skeletal muscle. Structurally, FXYD1 contains distinct domains with different functional and stability properties. The extracellular segment (residues 1-17) exists in a protease-resistant configuration, while the intracellular portion (residues 38-72) shows high susceptibility to proteolytic degradation. Research has identified a stable limit peptide (residues 1-43) that retains the characteristic ion-channel activity of the full-length protein while showing reduced voltage-dependent inactivation .

Topological analysis reveals that FXYD1 spans the membrane with its N-terminus oriented toward the extracellular space and its C-terminus facing the cytoplasm. This orientation is critical for its interaction with other membrane proteins, particularly the Na+/K+-ATPase, where it serves as a regulatory subunit affecting ion transport activity .

What are the primary physiological roles of FXYD1 in different tissues?

FXYD1 functions primarily as a regulator of the Na+/K+-ATPase, a critical ion transport protein that maintains electrochemical gradients across cell membranes. This regulatory function has tissue-specific impacts:

  • Cardiac tissue: FXYD1 modulates cardiac contractility by regulating Na+/K+-ATPase activity. Its absence results in increased cardiac mass, larger cardiomyocytes, and higher ejection fractions, suggesting a role in controlling cardiac performance and remodeling .

  • Brain tissue: In neurological tissues, FXYD1 influences dendritic spine formation and neuronal development. It is a target of MeCP2 and plays a crucial role in the pathogenesis of Rett syndrome, a neurodevelopmental disorder .

  • Pulmonary system: Recent research has identified a protective role of FXYD1 against pulmonary hypertension. FXYD1 deficiency is associated with increased pulmonary arterial pressure, muscularization of pulmonary arterioles, and impaired right ventricular function .

The expression of FXYD1 is developmentally regulated through epigenetic mechanisms, particularly DNA methylation, which shows inverse correlation with FXYD1 transcript levels in brain and cardiac tissues during development .

How does FXYD1 interact with Na+/K+-ATPase to regulate ion transport?

FXYD1 modulates Na+/K+-ATPase activity through direct protein-protein interactions. As a regulatory subunit, it affects both the kinetics and substrate affinity of the pump. The phosphorylation state of FXYD1 is a critical determinant of this regulatory function.

In phospholemman-deficient mouse models, total Na+/K+-ATPase activity is reduced by approximately 50% in heart tissue. This occurs despite only modest reductions in total Na+/K+-ATPase expression, but with a significant 60% decrease in the α2-isoform specifically implicated in contractility control. This suggests that FXYD1 not only modulates enzyme activity directly but also influences the expression pattern of Na+/K+-ATPase isoforms .

The regulatory interaction involves:

  • Direct binding to Na+/K+-ATPase α-subunits

  • Phosphorylation-dependent changes in the interaction

  • Isoform-specific effects on pump kinetics

These interactions are tissue-specific and developmentally regulated, contributing to the fine-tuning of ion homeostasis in excitable tissues .

What are the recommended methods for expressing and purifying recombinant human FXYD1?

The expression and purification of recombinant human FXYD1 require specialized approaches due to its small size and transmembrane nature. Based on current research methodologies:

Expression Systems:

  • Bacterial expression (E. coli): Suitable for producing the protein in inclusion bodies, requiring subsequent refolding

  • Insect cell systems: Provide better post-translational modifications and membrane protein folding

  • Mammalian expression systems: Optimal for functional studies requiring native-like modifications

Purification Protocol:

  • Initial extraction using mild detergents (e.g., CHAPS, DDM) to maintain structural integrity

  • Affinity chromatography using His-tag or other fusion tags (GST, MBP) for initial capture

  • Size exclusion chromatography to separate monomeric from oligomeric forms

  • Ion exchange chromatography for final polishing

For functional studies, reconstitution into proteoliposomes or nanodiscs can maintain the protein in a native-like membrane environment. Researchers should verify protein activity through ion channel formation assays in lipid bilayers, as trypsinized FXYD1 (residues 1-43) retains characteristic ion-channel activity while showing altered voltage-dependent inactivation properties .

What techniques are most effective for studying FXYD1 phosphorylation states?

FXYD1 functions as a major substrate for multiple protein kinases, making phosphorylation analysis crucial for understanding its regulatory mechanisms. The following techniques provide comprehensive assessment of FXYD1 phosphorylation:

Analytical Techniques:

  • Phospho-specific antibodies: Enable detection of specific phosphorylated residues by Western blotting or immunofluorescence

  • Mass spectrometry: Provides precise identification of phosphorylation sites and quantitative analysis of modification stoichiometry

  • Phosphopeptide mapping: Allows comparative analysis of phosphorylation patterns under different conditions

  • 32P-labeling: Used for metabolic labeling and detection of newly phosphorylated protein in cellular systems

Functional Correlations:

  • Site-directed mutagenesis: Creating phosphomimetic (S/T→D/E) or phosphodeficient (S/T→A) mutants to assess functional consequences

  • In vitro kinase assays: Determine specific kinases responsible for FXYD1 phosphorylation

  • Phosphatase treatments: Reveal the effect of dephosphorylation on FXYD1 function

These techniques should be combined with functional assessments such as Na+/K+-ATPase activity assays, ion flux measurements, or electrophysiological recordings to establish precise structure-function relationships .

How can researchers effectively design knockout and knockdown models for studying FXYD1 function?

Creating appropriate genetic models is essential for studying FXYD1 physiological roles. Based on successful approaches in the literature:

Global Knockout Strategies:

  • CRISPR/Cas9-mediated gene editing targeting FXYD1 exons

  • Homologous recombination for complete gene deletion

  • Monitoring for compensatory expression of other FXYD family members

Tissue-Specific Approaches:

  • Cre-loxP systems with tissue-specific promoters (cardiac, neuronal, pulmonary)

  • Inducible knockout systems to avoid developmental confounds

Knockdown Alternatives:

  • siRNA or shRNA delivery for transient or stable reduction in expression

  • Antisense oligonucleotides for in vivo applications

Phenotypic Assessment Parameters:

  • Cardiac: Measure ejection fraction, cardiac mass, cardiomyocyte size, and Na+/K+-ATPase activity

  • Pulmonary: Evaluate pulmonary arterial pressure, right ventricular systolic function, and pulmonary vascular remodeling

  • Neurological: Assess dendritic spine formation and neurodevelopmental markers

Studies have demonstrated that FXYD1-deficient mice exhibit increased cardiac mass, larger cardiomyocytes, and 9% higher ejection fractions compared to wild-type animals, without hypertension. These models also show 50% lower total Na-K-ATPase activity with specific reduction in the α2-isoform expression, revealing compensatory cardiac responses to FXYD1 absence .

How does FXYD1 deficiency affect cardiac structure and function?

FXYD1 deficiency induces significant alterations in cardiac structure and function. Research using phospholemman-deficient mouse models has revealed:

Structural Changes:

  • Increased cardiac mass and left ventricular hypertrophy

  • Enlarged cardiomyocytes

  • Increased interstitial fibrosis in the left ventricle

Functional Alterations:

  • 9% higher ejection fraction measured by magnetic resonance imaging

  • Reduced Na+/K+-ATPase activity (50% lower than wild-type)

  • Altered Na+/K+-ATPase isoform expression, particularly a 60% reduction in the α2-isoform that controls contractility

  • Impaired left ventricular systolic function in knockout models, with decreased global longitudinal strain, global radial strain, and reverse peak longitudinal strain rate

These changes occur without hypertension, suggesting that FXYD1 directly regulates cardiac function rather than responding to pressure overload. The apparent paradox between increased ejection fraction and impaired systolic function indicates complex compensatory mechanisms that warrant further investigation .

What is the relationship between FXYD1 and pulmonary hypertension?

Recent research has established a protective role for FXYD1 against pulmonary hypertension:

Clinical Correlation:

  • Lower FXYD1 expression observed in lung samples from patients with idiopathic pulmonary arterial hypertension (IPAH) compared to controls

Experimental Evidence in FXYD1 Knockout Models:

  • Significantly elevated pulmonary arterial pressure

  • Increased muscularization of small pulmonary arterioles

  • Impaired right ventricular systolic function

  • Elevated nitrosative stress and inflammatory markers in the lungs and left ventricle

Quantitative Measurements:

  • Right ventricular systolic pressures (RVSP) significantly elevated in both male and female FXYD1 KO mice (27.3±1.5 mmHg in male KO vs. 20.6±1.2 mmHg in male WT; 26.8±1.2 mmHg in female KO vs. 20.1±1.7 mmHg in female WT)

  • Decreased pulmonary acceleration time to ejection time ratio (PAT:ET) in FXYD1 KO mice (0.371±0.015 vs. 0.411±0.012 in males)

The absence of FXYD1 results in cardiopulmonary redox signaling changes that predispose to pathophysiological features of pulmonary hypertension. This indicates FXYD1 may provide endogenous protection against oxidative and inflammatory injury in the pulmonary vasculature .

How do experimental models of FXYD1 modification compare with clinical cardiovascular conditions?

The translational relevance of FXYD1 experimental models to clinical cardiovascular conditions shows several parallels:

Comparative Analysis:

ParameterFXYD1 KO Mouse ModelClinical Cardiovascular Conditions
Ventricular hypertrophyPresentCommon in heart failure and hypertension
Na+/K+-ATPase activityReduced by 50%Altered in heart failure
Ejection fractionIncreased by 9%Preserved or reduced in different heart failure phenotypes
Pulmonary pressureElevatedElevated in pulmonary hypertension
FibrosisIncreased interstitial fibrosisPresent in many cardiovascular diseases

Clinical Relevance:

  • FXYD1 KO models replicate aspects of both left and right heart dysfunction seen in human disease

  • The paradoxical increase in ejection fraction with underlying contractile dysfunction parallels heart failure with preserved ejection fraction (HFpEF)

  • Lower FXYD1 expression in lungs from IPAH patients suggests potential clinical relevance as a biomarker or therapeutic target

These correlations suggest that modulation of FXYD1 function may have therapeutic potential in various cardiovascular conditions, particularly those involving altered myocardial contractility or pulmonary vascular resistance .

How is FXYD1 expression regulated in neural tissues during development?

FXYD1 expression in neural tissues follows a complex developmental program regulated primarily through epigenetic mechanisms:

Developmental Regulation:

  • DNA methylation at the Fxyd1a promoter increases during brain development, correlating with changes in mRNA expression

  • Distinct epiallele profiles (methylation patterns) are detected at different developmental stages in brain tissue

  • Temporal-specific epigenetic programming contributes to developmental regulation of FXYD1

Transcript Isoforms:

  • Two major FXYD1 transcript isoforms (Fxyd1a and Fxyd1b) show differential expression patterns during development

  • Expression levels inversely correlate with DNA methylation status at their respective promoters

  • Methylation-mediated silencing represents a key regulatory mechanism for tissue-specific expression

The precise temporal regulation of FXYD1 expression during brain development suggests its critical role in proper neuronal maturation, particularly in dendritic tree and spine formation, which may explain its involvement in neurodevelopmental disorders like Rett syndrome .

What role does FXYD1 play in neurodevelopmental disorders like Rett syndrome?

FXYD1 has emerged as a significant factor in neurodevelopmental disorders, particularly Rett syndrome:

Molecular Mechanism:

  • FXYD1 is a direct target of MeCP2 (methyl-CpG binding protein 2), the gene mutated in Rett syndrome

  • Altered FXYD1 expression contributes to abnormal dendritic tree and spine formation in neurons

  • Dysregulation of Na+/K+-ATPase activity in neuronal membranes affects neuronal excitability and synaptic function

Functional Consequences:

  • Impaired neuronal development and connectivity

  • Altered neuronal excitability due to disrupted ion homeostasis

  • Potential contribution to the neurological phenotypes observed in Rett syndrome patients

Research Approaches:

  • Correlating FXYD1 levels with disease severity in Rett syndrome models

  • Assessing whether FXYD1 modulation can ameliorate neurological symptoms

  • Investigating interactions between MeCP2 and FXYD1 promoter regions

The critical role of FXYD1 in neural development and its regulation by MeCP2 makes it a potential therapeutic target for neurodevelopmental disorders characterized by abnormal neuronal morphology and function .

How can structural domain analysis of FXYD1 inform therapeutic development?

Structural analysis of FXYD1 domains provides crucial insights for therapeutic development:

Domain-Function Relationships:

  • The extracellular segment (residues 1-17) shows high protease resistance, suggesting a stable structural domain that could be targeted with minimal degradation

  • The intracellular portion (residues 38-72) is highly susceptible to proteases but contains key phosphorylation sites that regulate function

  • The limit peptide (residues 1-43) retains ion-channel activity with altered voltage-dependent inactivation properties, suggesting functional domains within this region

Therapeutic Implications:

  • Peptide mimetics targeting specific FXYD1 domains could modulate Na+/K+-ATPase activity without complete inhibition

  • Small molecules that alter FXYD1 phosphorylation state could provide tunable regulation of cardiac contractility

  • Stabilized recombinant FXYD1 domains could serve as biological therapeutics for conditions associated with FXYD1 deficiency

Structural studies reveal that conductance through FXYD1 channels exhibits rapid inactivation during depolarizing ramps at voltages greater than ±50 mV, while channels formed by trypsinized FXYD1 or recombinant FXYD1 1-43 show dramatic reductions in voltage-dependent inactivations. These differences highlight structure-function relationships that could be exploited for therapeutic development .

What contradictions exist in current FXYD1 research and how might they be resolved?

Several notable contradictions or paradoxes exist in current FXYD1 research that warrant further investigation:

Contradictory Findings:

  • Cardiac Function Paradox: FXYD1 knockout mice show both increased ejection fraction (by 9%) and impaired left ventricular systolic function with decreased strain measurements. This apparent contradiction suggests complex compensatory mechanisms .

  • Na+/K+-ATPase Activity: While FXYD1 is generally considered an inhibitor of Na+/K+-ATPase, its absence leads to 50% reduction in total Na+/K+-ATPase activity, contrary to expectations of increased activity .

  • Isoform-Specific Effects: FXYD1 deficiency has disproportionate effects on Na+/K+-ATPase α2-isoform (60% reduction) compared to total Na+/K+-ATPase expression, suggesting complex regulatory relationships beyond simple inhibition .

Resolution Approaches:

  • Temporal studies: Investigate whether these contradictions represent different phases of adaptive responses

  • Tissue-specific conditional knockouts: Determine if contradictions arise from systemic compensation

  • Proteomic analysis: Identify changes in interacting partners that might explain paradoxical findings

  • Biophysical studies: Directly measure the effect of FXYD1 on Na+/K+-ATPase kinetics in different contexts

Resolving these contradictions will require integrative approaches combining molecular, cellular, and systems-level analyses to fully understand the complex regulatory roles of FXYD1 .

What emerging technologies hold promise for advancing FXYD1 research?

Several cutting-edge technologies show significant potential for advancing FXYD1 research:

Emerging Methodological Approaches:

  • Cryo-electron microscopy (Cryo-EM): Enables high-resolution structural determination of FXYD1 in complex with Na+/K+-ATPase without crystallization, revealing dynamic interaction interfaces.

  • Single-molecule FRET: Allows real-time monitoring of conformational changes in FXYD1 during interactions with Na+/K+-ATPase or in response to phosphorylation.

  • CRISPR-based epigenome editing: Enables precise modification of methylation patterns at FXYD1 promoters to study epigenetic regulation in specific tissues and developmental stages.

  • Tissue-specific proteomics: Identifies the complete interactome of FXYD1 in different tissues to map its diverse functional roles.

  • Organ-on-chip technology: Provides physiologically relevant models to study FXYD1 function in human tissue contexts, particularly for cardiovascular and pulmonary applications.

Future Research Directions:

  • Development of small molecule modulators of FXYD1 function as potential therapeutics for heart failure and pulmonary hypertension

  • Investigation of FXYD1 as a biomarker for early detection of cardiopulmonary disorders

  • Exploration of FXYD1 role in other tissues where Na+/K+-ATPase regulation is critical but less studied

These technologies promise to overcome current limitations in understanding FXYD1 structure-function relationships and could accelerate therapeutic development targeting this important regulatory protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.