Recombinant Human Pituitary adenylate cyclase-activating polypeptide type I receptor (ADCYAP1R1)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Expression

ADCYAP1R1 is encoded by the ADCYAP1R1 gene (chromosome 7) and exists as multiple isoforms due to alternative splicing. Key structural features include:

  • Transmembrane domains: 7 transmembrane helices characteristic of class B GPCRs .

  • Recombinant fragment: Produced as a 21–120 amino acid (aa) fragment in wheat germ, suitable for biochemical assays like SDS-PAGE and ELISA .

  • Tissue distribution: Expressed in adrenal medulla, pancreas, uterus, brain, and peripheral ganglia .

FeatureDetailsSource
Protein lengthFull-length: 496 aa; recombinant fragment: 21–120 aa
Expression systemWheat germ (recombinant form)
Key splice variantsNull, Hip, Hop, and HipHop isoforms (differ in intracellular loops)

Functional Signaling Pathways

ADCYAP1R1 binds PACAP-27 and PACAP-38 with high affinity, activating Gαs and Gαq proteins to stimulate downstream effectors:

  • Adenylyl cyclase: Increases intracellular cAMP, modulating hormone secretion (e.g., ACTH, LH) .

  • Phospholipase C: Activates via Gαq, generating IP3 and DAG to mobilize calcium and activate PKC .

  • β-arrestin signaling: Internalizes to endosomes, triggering ERK-mediated pathways .

Key Physiological Roles:

  • Neurotransmission: Regulates synaptic plasticity and hippocampal activity .

  • Stress response: Modulates hypothalamic-pituitary-adrenal (HPA) axis activity .

  • Metabolism: Influences glucose homeostasis and energy balance .

Genetic Variants and Disease Associations

The SNP rs2267735 in ADCYAP1R1 has been extensively studied for its role in PTSD and anxiety disorders:

Study DesignKey FindingsSource
fMRI in traumatized womenCC genotype associated with heightened amygdala/hippocampus reactivity to threats
Longitudinal fear conditioningCC carriers show increased fear-potentiated startle (FPS) with trauma exposure
Epigenetic analysisHigher methylation at CpG sites linked to asthma risk in Puerto Rican children

Sex-Specific Effects:

  • Females: CC genotype correlates with PTSD severity and estrogen-regulated PACAP signaling .

  • Males: Limited evidence for direct PTSD association, but ADCYAP1R1-CRHR1 interactions may influence stress responses .

Diagnostic Tools

ELISA Kits:

ParameterValueSource
Sensitivity0.094 ng/ml
Detection Range0.156–10 ng/ml
Sample CompatibilitySerum, plasma, lysate

Therapeutic Targets

  • PTSD: Targeting PACAP-PAC1 signaling to modulate fear circuitry (e.g., reducing amygdala hyperactivity) .

  • Asthma: Epigenetic modifications of ADCYAP1R1 may offer biomarkers for early intervention .

Functional Studies

  • Hippocampal Excitability: PACAP enhances granule cell excitability via PAC1 receptors, amplifying synaptic responses .

  • Fear Conditioning: CC carriers exhibit impaired safety signal learning and exaggerated startle responses .

Genetic Interactions

Gene InteractionEffect on PTSD SeverityPopulationSource
ADCYAP1R1 × FKBP5Synergistic reduction in PTSD symptomsTraumatized Chinese
ADCYAP1R1 × CRHR1Male-specific modulation of cortisol regulationTraumatized males

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our standard shipping method includes normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADCYAP1R1; Pituitary adenylate cyclase-activating polypeptide type I receptor; PACAP type I receptor; PACAP-R-1; PACAP-R1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-468
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPEL FRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYE SETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRA ISVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFF PERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVN FVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRE RLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFAVDFKHRHPSLASSGV NGGTQLSILSKSSSQIRMSGLPADNLAT
Uniprot No.

Target Background

Function
This protein serves as a receptor for PACAP-27 and PACAP-38. Its activity is mediated by G proteins, which activate adenylyl cyclase. This receptor may regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. It may also play a role in spermatogenesis and sperm motility. Additionally, it induces smooth muscle relaxation and secretion within the gastrointestinal tract.
Gene References Into Functions
  1. These findings demonstrate that b-arrestin1 and b-arrestin2 exhibit differential effects on PAC1R internalization and PAC1R-dependent ERK1/2 activation, suggesting that these two b-arrestin isoforms may contribute to fine-tuning the PAC1R signaling pathways. PMID: 29734363
  2. Research suggests that stress levels and circulating gonadal hormones may differentially regulate the PACAPergic system in males and females, potentially influencing anxiety-like behavior and contributing to discrepancies in human psychiatric disorders. [Review Article] PMID: 28610473
  3. The results provide evidence for an association between ADCYAP1R1 and PTSD, indicating potential sex-specific differences. PMID: 28746747
  4. These findings suggest a model wherein E2 induces the expression of ADCYAP1R1 through binding of ERalpha at the ERE as an adaptive response to stress. Inhibition of E2/ERalpha binding to the ERE containing the rs2267735 risk allele leads to reduced expression of ADCYAP1R1, diminishing estrogen regulation as an adaptive stress response and potentially increasing risk for PTSD. PMID: 27959335
  5. Data indicate that GCGR (glucagon receptor) activation proceeds via a mechanism in which transmembrane helix 6 (TM6) is held in an inactive conformation by a conserved polar core and a hydrophobic lock (involving intracellular loop 3, IC3). Mutations in the corresponding polar core of GCGR or PAC1R disrupt these inhibitory elements, allowing TM6 to swing outward, and inducing constitutive G protein signaling. PMID: 28356352
  6. Results confirmed for the first time that doxycycline specifically targeted pituitary adenylate cyclase-activating polypeptide (PACAP) receptor type 1 (PAC1) imitating PACAP(30-37) and acted as an enhancer by facilitating the subsequent ligand binding and the activation of PAC1. PMID: 26700245
  7. Results suggest that impaired contextual conditioning in the hippocampal formation may mediate the association between type I receptor of the pituitary adenylate cyclase activating polypeptide and and posttraumatic stress disorder symptoms. PMID: 25680674
  8. Data show that glucocorticoid response genes NR3C1, ADCYAP1R1 and HSD11B2 were relatively hypomethylated whereas FKBP5 was hypermethylated. PMID: 26343289
  9. Further investigations of genetic factors for trauma-related psychopathology should include careful assessments of the social environment PMID: 26334183
  10. High child stress and an ADCYAP1R1 single-nucleotide polymorphism are associated with reduced bronchodilator response in children with asthma. PMID: 25918834
  11. and its receptor (PAC1) are involved in stress response and anxiety. PMID: 23972788
  12. association of variants with sudden infant death not supported PMID: 23981011
  13. PAC1/PACAP receptor endocytosis contributes to ERK acktivation. PMID: 24696141
  14. This review focuses on the role of the PAC1 receptor in brain development, the behavior of transgenic animals, and its potential implications in human neurodevelopmental disorders. PMID: 24220567
  15. PAC1 receptor (ADCYAP1R1) genotype is associated with dark-enhanced startle in both male and female children. PMID: 22776899
  16. Individual differences in ADCYAP1R1 genotype may contribute to dysregulated fear circuitry known to play a central role in posttraumatic stress disorder and other anxiety disorders. PMID: 24516127
  17. Data indicate that VIP and PACAP increased macrophage resistance to HIV-1 replication by inducing the synthesis of beta-chemokines CCL3 and CCL5 and IL-10 following preferential activation of the receptors VPAC2 and PAC1. PMID: 23818986
  18. The findings suggest that the PACAP-PAC1 receptor pathway may play a significant role in female human responses to traumatic stress PMID: 23394710
  19. ADCYAP1R1 genotype may be involved in post-traumatic stress symptoms in highly traumatized African-American females PMID: 23505260
  20. Genetic variation at the ADCYAP1R1 locus interacts with child abuse to shape the risk of later posttraumatic stress disorder (PTSD) in women. PMID: 23280952
  21. Epigenetic and genetic variants in ADVYAP1R1 are associated with asthma in Puerto Rican children. PMID: 23328528
  22. [review] The Adcyap1r1 receptor single nucleotide polymorphism (SNP) is located within a predicted estrogen response element (ERE). PMID: 23147486
  23. Conclude that VPAC2/PAC1 receptors require NO in series to effect cutaneous active vasodilation during heat stress in humans. PMID: 22961270
  24. The increased expressions of PAC1 receptors on lactating breast may indicate a PACAP38/PAC1 interaction in the mammary gland during lactation. PMID: 22539193
  25. PAC1 regulates PYK-2 tyrosine phosphorylation in a calcium-dependent manner in lung cancer cell lines. PMID: 22581436
  26. Activation of Sp1 by the Ras/MAPK pathway might participate in neuron-specific expression of the PAC1 gene. PMID: 22609358
  27. A reported association between rs2267735 and PTSD could not be replicated in either African American or European American females in two large independent samples. PMID: 21912390
  28. The present study provides the first characterization of the binding domains of PACAP to its specific receptor PAC1 and suggests heterogeneity within the binding mode of peptide ligands to class B GPCRs. PMID: 21185349
  29. VPAC2 and/or PAC1 receptor activation is involved in cutaneous active vasodilation in humans. PMID: 20395540
  30. Results indicate that VPAC1, but not VPAC2 or PAC1, up-regulation in macrophages is a common mechanism in response to acute and chronic pro-inflammatory stimuli. PMID: 20026142
  31. PACAP receptor type 1 mRNA is expressed in the trigeminal, otic, and superior cervical ganglia (prejunctional) and cerebral arteries (postjunctional). PMID: 11930171
  32. HCT8 human colon tumor cells express PAC1, and PAC1 activation is coupled to adenylate cyclase, increased cytosolic [Ca(2+)](i), and cellular proliferation PMID: 12409223
  33. Using GST pull-down assay, ARF6 binds to the hop1 but not the null domain of the PAC1 receptor PMID: 12409233
  34. receptors were positively coupled to adenylyl cyclase in human lung cancer, but the enzyme activity was impaired compared to normal lung PMID: 12732341
  35. Expression of functional PAC(1), VPAC(1), and VPAC(2) receptors in human prostate, as well as its maintenance after malignant transformation PMID: 12948842
  36. In colon cancer cell lines, PAC1 is expressed as the SV1 or HIP splice variant and is coupled to the activation of only cAMP, but not intracellular Ca2+. PMID: 14742913
  37. The PAC(1)-R null variant is the most relevant isoform expressed in human prostate cancer and may be related to the events determining the outcome of prostate cancer. PMID: 16372333
  38. Stimulation of endogenously expressed PAC1 receptors with PACAP in human neuroblastoma cells increased APPsalpha secretion. PAC1R activation stimulates ERK phosphorylation. PMID: 16401644
  39. PAC1-R is the predominant PACAP receptor found in fetuses, and both PAC1-R and VPAC1-R are expressed in the mature cerebellum. PMID: 16572459
  40. Data demonstrate that altered neuronal proliferation/apoptosis and disrupted ependymal cilia are the main factors contributing to hydrocephalus in PAC1-overexpressing mice. PMID: 16823490
  41. PACAP may regulate the biological release of peptides and serotonin from BON cells PMID: 16888199

Show More

Hide All

Database Links

HGNC: 242

OMIM: 102981

KEGG: hsa:117

UniGene: Hs.377783

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Most abundant in the brain, low expression in the lung, liver, thymus, spleen, pancreas and placenta.

Q&A

What is ADCYAP1R1 and what is its relationship to PACAP?

ADCYAP1R1 (also known as PAC1) is a G-protein coupled receptor that shows high-affinity binding to pituitary adenylate cyclase-activating polypeptide (PACAP). This receptor binds PACAP with approximately 1,000-fold higher affinity than other related peptides such as VIP . ADCYAP1R1 serves as the primary mediator of PACAP's neurobiological effects, particularly in stress response pathways and fear processing circuits. The receptor's activation triggers intracellular signaling cascades that regulate neural activity, plasticity, and cellular survival mechanisms.

How is ADCYAP1R1 distributed in neural tissue?

ADCYAP1R1 shows selective distribution in the brain, with expression patterns that align with its functional roles. Detailed analysis using dual in situ hybridization techniques has revealed:

  • High expression in the amygdala, a key structure in fear processing

  • Selective expression in Slc32a1-expressing cells (GABAergic neurons)

  • Low expression in hippocampal CA subfields

  • Dense PACAP binding sites in the hippocampus

This distribution pattern supports ADCYAP1R1's involvement in emotional regulation and stress response, with particular concentration in regions mediating fear and anxiety responses.

What methodologies are most effective for measuring ADCYAP1R1 expression?

For accurate assessment of ADCYAP1R1 expression in neural tissue, researchers should consider:

  • Sensitive dual in situ hybridization (DISH) methods that enable co-localization with neurochemical markers (e.g., Slc17a7, Slc17a6, and Slc32a1)

  • Light microscopy with both low- and high-magnification capabilities for precise anatomical localization of expression patterns

  • Quantitative PCR for mRNA expression analysis, with appropriate controls

  • For protein analysis, immunohistochemistry with validated antibodies

When genotyping ADCYAP1R1 variants, the following approaches have proven effective:

  • TaqMan SNP Genotyping Assay with TaqMan GTXpress Master Mix on the ViiA7 Real-Time PCR system

  • Sequenom SNP genotyping platform using iPlex gold reagents and the MassARRAY system

Recommended quality control measures include:

  • Within-plate duplicates and non-template controls

  • Minimum 25% sample duplication across platforms

  • Verification of Hardy-Weinberg Equilibrium

  • Call rates exceeding 95%

What is the significance of the rs2267735 polymorphism in ADCYAP1R1?

The rs2267735 polymorphism represents a single nucleotide polymorphism (SNP) in the ADCYAP1R1 gene that has been linked to fear responses and risk for post-traumatic stress disorder (PTSD), particularly in women. Key characteristics include:

  • Location within a putative estrogen response element, suggesting hormone-dependent effects

  • Association with decreased expression of the PACAP receptor

  • Risk genotype (CC) linked to increased amygdala and hippocampal responses to fearful stimuli

  • Reduction in functional connectivity between amygdala and hippocampus in risk genotype carriers

This polymorphism appears to function as an intermediate phenotype between genetic risk factors and psychiatric outcomes, with ADCYAP1R1 genotype showing larger effects than PTSD diagnosis in some studies .

How does ADCYAP1R1 influence neural circuit function?

ADCYAP1R1 modulates neural circuit function through several mechanisms:

  • Amygdala reactivity:

    • Risk genotype (CC) associated with hyperreactive amygdala responses to fearful stimuli

    • May predispose individuals to pathological responses to traumatic stress

  • Circuit connectivity:

    • Regulates functional connectivity between amygdala and hippocampus

    • Influences integration between emotional processing and contextual memory

  • Synaptic plasticity:

    • PACAP facilitates synaptic plasticity in the hippocampus

    • Decreased receptor expression may lead to decreased plasticity in amygdala and hippocampus

  • Sensory integration:

    • Involved in networks that allow environmental cues to guide motor output

    • Participates in well-established sensory input-to-motor output pathways

Brain RegionADCYAP1R1 EffectsFunctional Implications
AmygdalaIncreased reactivity to fear stimuli in risk genotypeEnhanced fear responses, potential PTSD vulnerability
HippocampusDense PACAP binding sites, neurotrophic effectsMemory formation, contextual fear processing
Amygdala-Hippocampus CircuitReduced functional connectivity in risk genotypeImpaired contextual modulation of fear responses
Prefrontal-Amygdala CircuitInvolvement in regulation of amygdala reactivityEmotion regulation deficits in risk carriers

What are the sex-specific aspects of ADCYAP1R1 function?

ADCYAP1R1 demonstrates pronounced sex-specific effects that are particularly relevant to psychiatric research:

  • The association between ADCYAP1R1 variants and PTSD has been identified primarily in women, not men

  • The rs2267735 polymorphism is located within a putative estrogen response element

  • PACAP may influence neural structure and function in an estrogen-dependent manner

  • Research protocols should account for estrogen levels or estrous cycling when investigating ADCYAP1R1 function

These findings suggest an important interaction between ADCYAP1R1 signaling and sex hormones that may contribute to sex differences in stress-related disorders, particularly PTSD.

How does ADCYAP1R1 contribute to PTSD vulnerability?

Multiple lines of evidence implicate ADCYAP1R1 in PTSD vulnerability:

The current evidence indicates that ADCYAP1R1 represents an intermediate phenotype positioned between genetic risk factors and clinical outcomes, with brain structure and function reflecting an aggregate of genetic and environmental factors relevant to PTSD risk .

What experimental designs best capture ADCYAP1R1's role in fear processing?

Optimal experimental designs for investigating ADCYAP1R1's role in fear processing should incorporate:

  • Imaging approaches:

    • Functional MRI using fearful vs. neutral stimuli paradigms

    • Region of interest (ROI) analyses targeting amygdala and hippocampus

    • Functional connectivity analyses examining circuit-level effects

  • Genotype considerations:

    • Grouping by risk genotype (CC) vs. non-risk genotype (GC/GG)

    • Analyzing genotype effects using both categorical and additive models

    • Matching groups for confounding variables such as trauma exposure and symptom severity

  • Physiological measures:

    • Startle reflex paradigms to assess fear potentiation

    • Safety signal learning protocols

    • Stress reactivity measures

  • Controlling for confounding variables:

    • Matching for childhood and adult trauma exposure

    • Controlling for PTSD and depression symptom severity

    • Considering estrogen levels in female participants

The study by PNAS demonstrated the value of this approach by matching genotype groups for trauma exposure and symptom severity, thereby isolating the independent effects of ADCYAP1R1 genotype on neural function .

How might understanding ADCYAP1R1 inform therapeutic approaches for PTSD?

Research on ADCYAP1R1 has several important implications for PTSD treatment:

  • Plasticity-based interventions:

    • PACAP facilitates synaptic plasticity in key brain regions

    • The risk genotype may lead to decreased plasticity in fear-related circuits

    • This has "important implications for current therapeutic approaches that rely on neural plasticity for symptom improvement, such as prolonged exposure therapy"

  • Personalized treatment approach:

    • Genotyping patients for ADCYAP1R1 variants might predict treatment response

    • Those with the risk genotype might require modified therapeutic protocols to overcome plasticity deficits

  • Potential pharmacological targets:

    • The PACAP-PAC1 system could represent a novel target for PTSD therapeutics

    • Compounds enhancing PACAP signaling or bypassing deficient plasticity mechanisms might benefit risk genotype carriers

  • Research priorities:

    • "Future studies that specifically measure effects of ADCYAP1R1 genotype on neural plasticity are needed"

    • Understanding how genetic risk translates to neural circuit abnormalities could inform more targeted interventions

What are the methodological challenges in studying ADCYAP1R1 genotype-phenotype relationships?

Researchers investigating ADCYAP1R1 should be aware of several methodological challenges:

  • Sample size considerations:

    • "The small effect sizes typically observed for associations between genetic polymorphisms and psychiatric pathology require large sample sizes to reliably detect an effect"

    • Some studies have failed to replicate genetic associations due to insufficient power

  • Intermediate phenotype approach:

    • Focusing on neural circuit function rather than diagnostic categories may provide greater statistical power

    • Amygdala reactivity represents a more proximal outcome to genetic variation than clinical diagnosis

  • Multiple levels of analysis:

    • Integrating genetic, neural, and behavioral/clinical data requires specialized analytical approaches

    • Future research should focus on "linking all three levels of analysis (genes, neural systems, and symptoms)"

  • Sex-specific effects:

    • Studies should account for potential estrogen-dependent mechanisms

    • Hormone levels and menstrual cycle phase should be measured and controlled for

  • Population stratification:

    • Genetic studies should control for population stratification effects

    • The study described recruited specifically African-American women to "reduce effects of genetic admixture"

How do environmental factors interact with ADCYAP1R1 genotype?

While the search results focus primarily on genetic aspects of ADCYAP1R1 function, several points suggest important gene-environment interactions:

  • Trauma exposure:

    • The ADCYAP1R1 risk genotype may interact with trauma exposure to influence PTSD risk

    • The cited study controlled for trauma by matching genotype groups for childhood and adult trauma levels

  • Epigenetic mechanisms:

    • The study notes that it "cannot disentangle whether the results represent direct effects of the polymorphism on expression of the PACAP receptor or whether they are linked to differential gene methylation"

    • Previous research has associated ADCYAP1R1 methylation with PTSD

  • Hormonal environment:

    • Estrogen levels may modulate ADCYAP1R1 function given the location of rs2267735 in a putative estrogen response element

    • This suggests a complex interaction between genetic predisposition and hormonal state

  • Neural plasticity:

    • Environmental factors may interact with ADCYAP1R1 genotype to affect neural plasticity

    • "Neurobiological phenotypes may provide greater power to predict psychopathology, as brain structure and function reflect an aggregate of genetic and environmental factors"

What are the most promising directions for future ADCYAP1R1 research?

Based on the current state of knowledge, several research directions appear particularly promising:

  • Neural plasticity mechanisms:

    • "Future studies that specifically measure effects of ADCYAP1R1 genotype on neural plasticity are needed"

    • Understanding how ADCYAP1R1 affects synaptic plasticity could inform therapeutic approaches

  • Multi-level analysis:

    • Future research should focus on "linking all three levels of analysis (genes, neural systems, and symptoms)"

    • Determining whether "neural activation and connectivity might add additional predictive value, above and beyond genotype, in predicting PTSD"

  • Sex-specific mechanisms:

    • Investigating "how individual differences in ADCYAP1R1 interact with varying estrogen levels in adults and over development"

    • Examining "possible contributions to sex differences in healthy responses to threat stimuli"

  • Larger samples with diverse populations:

    • Expanding beyond the relatively small, specific samples used in current research

    • Examining whether findings generalize across different ethnic and demographic groups

  • Circuit-level analysis:

    • Further investigation of "PACAP-dependent networks involved in sensory integration allowing environmental cues to guide motor output"

    • More detailed mapping of ADCYAP1R1 expression within specific neural circuits

What are the optimal protocols for functional connectivity analysis related to ADCYAP1R1?

Based on published methodology, researchers investigating ADCYAP1R1-related functional connectivity should consider the following protocol elements:

  • Task-based functional connectivity approach:

    • Employ the CONN toolbox for connectivity analysis

    • Define seed regions anatomically (e.g., mean time course across voxels within bilateral amygdala)

    • Examine covariance with seed regions voxel-wise across the whole brain

  • Control for confounding factors:

    • Model individual participants' motion parameters as nuisance covariates

    • Control for spontaneous, non-task-related covariance between regions by examining statistical contrasts (e.g., fearful vs. neutral stimuli)

    • Include only regions showing significantly increased connectivity with the amygdala for fearful relative to neutral faces

  • ROI selection:

    • Define hippocampal ROI using anatomical masks

    • Include prefrontal ROIs encompassing anterior cingulate and medial prefrontal cortex regions involved in emotion regulation

    • Selection should be guided by regions known to regulate amygdala reactivity

  • Analysis approach:

    • Conduct group-level analyses comparing participants with and without the risk allele

    • Focus on connectivity patterns relevant to emotional processing and regulation

    • Correlate connectivity measures with behavioral or clinical variables when possible

This methodology has successfully identified reduced functional connectivity between the amygdala and hippocampus in carriers of the ADCYAP1R1 risk genotype .

How should researchers design experiments to investigate ADCYAP1R1's role in fear learning?

Effective experimental designs for investigating ADCYAP1R1's role in fear learning should incorporate:

  • Participant selection:

    • Genotype participants for the rs2267735 polymorphism

    • Create matched groups (risk genotype vs. non-risk genotype) controlling for:

      • Childhood trauma exposure

      • Adult trauma exposure

      • PTSD symptom severity

      • Depression symptoms

  • Fear conditioning paradigms:

    • Include acquisition, extinction, and recall phases

    • Measure both physiological (e.g., skin conductance) and neural responses

    • Include safety signal learning components, as deficits have been observed in risk genotype carriers

  • Imaging protocols:

    • Use fearful vs. neutral stimulus contrasts

    • Focus on amygdala and hippocampus ROIs

    • Assess both activation magnitude and functional connectivity

  • Additional measures:

    • Startle reflex assessment, which is modulated by the amygdala and influenced by ADCYAP1R1

    • Context-dependent fear tasks to assess hippocampal involvement

    • Measures of cognitive flexibility related to fear responses

  • Analysis considerations:

    • Examine both categorical (risk vs. non-risk) and continuous (allele load) effects of genotype

    • Consider sex and hormonal status as potential moderating variables

    • Analyze network-level effects in addition to regional activation

What considerations are important when studying ADCYAP1R1 in non-neural tissues?

While the search results focus primarily on neural expression, they also indicate important considerations for studying ADCYAP1R1 in other tissues:

  • Bone marrow research:

    • ADCYAP1R1 (PAC1) is expressed in mouse bone marrow cells

    • PAC1+ cells may represent hematopoietic progenitor cells (HPCs)

    • These cells were characterized as "large in size, had oval nuclei and merged with CD34+ cells"

  • Autonomic nervous system connections:

    • PACAP mRNA and protein are expressed in paravertebral sympathetic ganglia that innervate bone marrow

    • PACAP is present in sympathetic fibers of the bone marrow cavity

    • This suggests "sympathetic nerve innervation may be responsible for PACAP-regulated hematopoiesis in BM, mainly via PAC1"

  • Methodological approaches:

    • Co-expression analysis with tissue-specific markers (e.g., CD34 for HPCs)

    • Functional assays such as colony-forming unit (CFU) assays for hematopoietic progenitors

    • Assessment of cell cycle markers like cyclinD1 and Ki67

  • Experimental design:

    • Consider knockout models (e.g., adcyap1-/- mice)

    • Use of receptor antagonists (PACAP6-38, VIP6-28) to confirm receptor specificity

    • Analysis of both receptor expression and functional response to ligand

This broader perspective on ADCYAP1R1 function highlights its diverse physiological roles beyond neural circuits and suggests important areas for translational research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.