Recombinant Human Pituitary tumor-transforming gene 1 protein-interacting protein (PTTG1IP)

Shipped with Ice Packs
In Stock

Description

Cancer Biology

  • Thyroid Cancer:

    • Overexpression in transgenic mice induces thyroid hyperplasia and represses sodium iodide symporter (NIS) activity, reducing radioiodine uptake .

    • Associated with increased Akt signaling and cyclin D1 expression, driving cell proliferation .

  • Breast Cancer:

    • Strong immunohistochemical expression correlates with tumor grade and metastatic potential .

    • Secreted PTTG1IP enhances cell invasion and metastasis .

  • Lung Cancer:

    • Promoter hypermethylation reduces PTTG1IP expression in early-stage NSCLC, linked to inhibited cell proliferation in vitro .

Therapeutic Delivery

  • CRISPR-Cas9 Delivery:

    • PTTG1IP-engineered extracellular vesicles (EVs) deliver Cas9-sgRNA complexes, achieving 6% gene editing efficiency in HEK293T cells .

    • EV-mediated delivery outperforms CD63-based scaffolds by 2-fold in Cas9 transport .

Iodide Uptake Regulation

  • Inhibits NIS mRNA expression and iodide transport in thyroid cells, impacting radioiodine therapy efficacy .

Functional Insights from Recombinant Studies

Mechanistic Interactions:

  • Binds pituitary tumor-transforming 1 (PTTG1), facilitating its nuclear translocation to activate fibroblast growth factor 2 (bFGF) transcription .

  • Modulates p53 activity, destabilizing the tumor suppressor protein in transformed cells .

Oncogenic vs. Tumor-Suppressive Roles:

Cancer TypePTTG1IP RoleExperimental Evidence
ThyroidPro-oncogenicInduces hyperplasia and represses NIS
LungTumor-suppressiveHypermethylation reduces proliferation

Clinical Implications

  • Diagnostic Biomarker: Hypermethylated PTTG1IP promoters in early-stage NSCLC could improve CT screening specificity .

  • Therapeutic Target: Blocking PTTG1IP-PTTG1 interactions may restore radioiodine uptake in thyroid cancer .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your specific request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
PTTG1IP; C21orf1; C21orf3; Pituitary tumor-transforming gene 1 protein-interacting protein; Pituitary tumor-transforming gene protein-binding factor; PBF; PTTG-binding factor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-180
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
PTTG1IP
Target Protein Sequence
QEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
Uniprot No.

Target Background

Function
May facilitate PTTG1 nuclear translocation.
Gene References Into Functions
  1. Immunoexpression of negative pituitary tumor-transforming gene 1 protein-interacting protein (PTTG1IP) was associated with a 1.5-fold increased risk of breast cancer death. PMID: 29078751
  2. Data suggests that mutations in PBF are likely passenger events, with overexpression of PBF being a more significant factor in human cancer. PMID: 28676500
  3. PTTG1IP and MAML3 were found to be associated with the severity of bronchiolitis obliterans syndrome (BOS) in adult asthma. The relevance of these genes is supported by eQTL analyses and the co-expression of PTTG1lP with vimentin and E-cadherin1, and MAML3 with MAML2. PMID: 27709636
  4. Research suggests that PBF and PTTG play a critical role in promoting thyroid cancer, which is predictive of poorer patient outcome. PMID: 28504713
  5. PBF exhibits a unique role in regulating CTTN function to promote endocrine cell invasion and migration. PMID: 27603901
  6. Studies demonstrate an emerging role for PBF in colorectal tumorigenesis through regulating p53 activity. These findings indicate that PBF could serve as a prognostic indicator for invasive tumors. PMID: 25408419
  7. These findings suggest that miR-584 suppresses glioma cell growth by negatively regulating the expression of PTTG1IP, indicating a tumor-suppressive role for miR-584 in human glioma pathogenesis. PMID: 25674221
  8. The protooncogene PBF acts as a negative regulator of p53 function in thyroid tumorigenesis, where PBF is generally overexpressed and p53 mutations are less common compared to other tumor types. PMID: 24506068
  9. Data from mutant recombinant proteins suggests that proto-oncogene PBF is a phosphoprotein, highlighting the importance of tyrosine residue Y174 in both endocytosis of PBF and its interaction/co-localization with NIS/SLC5A5 (sodium-iodide symporter). PMID: 23678037
  10. PBF expression may hold promise as a biomarker for prognostic and therapeutic purposes in patients with papillary thyroid carcinoma. PMID: 22888961
  11. Researchers identified pituitary tumor-transforming gene 1 (PTTG1) binding factor (PBF) as a target of miR-122 and demonstrated that hepatitis B virus replication leads to a notable increase in PBF levels. PMID: 23221562
  12. This study provides the first epidemiological evidence linking functional regulatory variants of PTTG1IP to the risk of ER-positive breast cancer, further supporting its role as a proto-oncogene in breast cancer. PMID: 22404099
  13. Overexpression of PBF causes thyroid cell proliferation, macrofollicular lesions, and hyperplasia, as well as repression of the critical therapeutic route for radioiodide uptake. PMID: 21844185
  14. A review discusses the role of PBF in endocrine cancer. PMID: 21129230
  15. PTTG expression was found to be higher in malignant cells compared to primary astrocytes, whereas PTTG-binding factor was not elevated in astrocytoma. PMID: 15178645
  16. Overexpression of PTTG and PBF in differentiated thyroid cancer has significant implications for the activity of the NIS gene, significantly impacting the efficacy of radioiodine treatment. PMID: 17297475

Show More

Hide All

Database Links

HGNC: 13524

OMIM: 603784

KEGG: hsa:754

STRING: 9606.ENSP00000328325

UniGene: Hs.474010

Subcellular Location
Membrane; Single-pass type I membrane protein. Cytoplasm. Nucleus. Note=According to PubMed:10781616, it is found in the cytoplasm and the nucleus.
Tissue Specificity
Ubiquitous.

Q&A

What is PTTG1IP and what is its relationship to PTTG1?

PTTG1IP (also termed PBF) is a ubiquitously expressed proto-oncogene that was first identified through its ability to bind to human securin, also known as pituitary tumor transforming gene (PTTG) . This protein functions as a crucial binding partner for PTTG1, potentially modulating its activity and cellular functions in both normal and pathological conditions . The interaction between these two proteins plays a significant role in cell cycle regulation and may contribute to tumorigenesis when dysregulated.

What experimental controls should be included when studying PTTG1IP expression?

When investigating PTTG1IP expression, researchers should include appropriate positive and negative tissue controls based on known expression patterns. Normal tissue panels can serve as negative controls as demonstrated in studies that found limited PTTG1IP presence in normal human tissue panels . For positive controls, cell lines with validated PTTG1IP expression should be used. Additionally, technical controls such as housekeeping genes (e.g., β-actin, GUSB) are essential for normalization in quantitative analyses .

How is PTTG1IP expression regulated at the epigenetic level?

PTTG1IP expression appears to be significantly regulated by epigenetic mechanisms, particularly DNA methylation. Research has demonstrated a strong negative correlation between the PTTG1IP promoter methylation level and its expression level in various cancer types including lung adenocarcinoma and lung squamous cell carcinoma . The Spearman correlation coefficients for this negative relationship were found to be −0.415 and −0.457 respectively, indicating that hypermethylation of the promoter region is associated with reduced PTTG1IP expression .

What methods are most effective for quantifying PTTG1IP at the transcriptional level?

For accurate quantification of PTTG1IP transcript levels, quantitative reverse transcription PCR (qRT-PCR) using platforms such as the LightCycler 480 with SYBR Green I Master Mix has proven effective . Target-specific primer sets (such as Hs_PTTG1IP_1_SG QuantiTect) should be employed following manufacturer protocols. The relative quantification method (2^(−ΔΔCt)) is commonly used to analyze expression levels, with experiments performed in triplicate to ensure reliability . Normalization against established housekeeping genes like GUSB is essential for accurate comparison across samples.

How can researchers effectively assess PTTG1IP protein expression in clinical samples?

Multiple complementary approaches should be used to comprehensively assess PTTG1IP protein expression:

  • Immunohistochemistry (IHC) using anti-PTTG1IP primary antibodies (typically at 1:100 dilution) with appropriate detection systems such as HRP-labeled secondary antibodies

  • Immunocytochemistry (ICC) for cellular localization studies, with both permeabilized and non-permeabilized conditions to distinguish between surface and intracellular expression

  • Immunofluorescence with FITC-conjugated secondary antibodies for more sensitive detection and co-localization studies

  • Western blotting or Dot-blot analysis for semi-quantitative assessment

  • ELISA for quantitative detection, particularly in serological samples

How does PTTG1IP expression differ across cancer types?

PTTG1IP expression patterns show significant variation across different cancer types. While it has been reported to be highly expressed in thyroid, breast, colorectal, and liver cancers , it appears to be significantly downregulated in non-small cell lung cancer (NSCLC) . In NSCLC tissues, PTTG1IP mRNA levels were reduced by approximately 43% compared to adjacent normal tissues . In multiple myeloma, studies have detected PTTG1IP expression in plasma cells, though the pattern differs from that of PTTG1 . These diverse expression patterns suggest context-dependent roles in different cancer types.

What is the relationship between PTTG1IP expression and cell proliferation in cancer models?

Research indicates that PTTG1IP may have anti-proliferative effects in certain cancer contexts. In lung cancer studies, overexpression of PTTG1IP significantly inhibited cell proliferation . This finding contrasts with the reported oncogenic roles of its binding partner PTTG1, suggesting complex and potentially opposing functions of these interacting proteins. Researchers investigating this relationship should design experiments that can distinguish between direct effects of PTTG1IP and indirect effects mediated through its interaction with PTTG1.

How can researchers differentiate between PTTG1 and PTTG1IP effects in experimental studies?

To differentiate between the effects of PTTG1 and PTTG1IP:

  • Perform selective knockdown/knockout experiments using siRNA or CRISPR-Cas9 targeting each gene individually

  • Conduct rescue experiments with wild-type and mutant forms that cannot interact with each other

  • Use proximity ligation assays to detect and quantify protein-protein interactions in situ

  • Employ co-immunoprecipitation studies to assess interaction under different experimental conditions

  • Design domain-specific constructs to identify regions essential for their interaction and separate functions

This approach enables researchers to delineate the independent and cooperative roles of these proteins in cancer progression.

What techniques are recommended for studying PTTG1IP promoter methylation?

For comprehensive analysis of PTTG1IP promoter methylation, several complementary approaches are recommended:

  • Reduced Representation Bisulfite Sequencing (RRBS) - This technique has been successfully used to analyze CpG island shores of the PTTG1IP promoter in early-stage NSCLC tissue samples

  • Illumina methylation beadchip HM450 K - This platform provides genome-wide methylation data and has been used in large-scale studies from The Cancer Genome Atlas (TCGA)

  • Bisulfite conversion followed by methylation-specific PCR for targeted analysis

  • Pyrosequencing for quantitative site-specific methylation analysis

Statistical analysis of methylation data should include correlation tests (such as Spearman's non-parametric correlation) to evaluate the relationship between gene methylation and expression levels .

What expression systems are optimal for generating recombinant PTTG1IP for in vitro studies?

Based on established protocols for similar proteins, the following expression systems are recommended for producing recombinant PTTG1IP:

  • Bacterial expression: PQE30 plasmid system in M15 E. coli cells with 6× His-tag for purification

  • IPTG induction at OD 0.6 followed by nickel column purification

  • Validation by SDS-PAGE to confirm protein integrity and purity

  • Final concentration adjustment to approximately 5 mg/ml for experimental use

This approach yields sufficient quantities of purified protein for various applications including structural studies, antibody production, and functional assays.

How should PTTG1IP be evaluated in relation to other genes in cancer signature studies?

When incorporating PTTG1IP in multi-gene expression analyses, researchers should consider its relationship with functionally related genes such as PTTG1 and ESPL1. Quantitative RT-PCR methodologies using platforms like LightCycler 480 with appropriate reference genes (e.g., GUSB) are recommended . Statistical analyses should include paired comparisons between different study groups (such as responders, non-responders, and controls) with appropriate significance testing.

The pattern of expression across these genes can provide valuable insights, as demonstrated by studies showing significant differences in ESPL1 (p < 0.0001) and PTTG1 (p = 0.0036) between disease groups and controls, while PTTG1IP may show different patterns (p = 0.1736) . These differential expression patterns can serve as potential biomarkers for disease classification or treatment response prediction.

What are the statistical considerations when analyzing PTTG1IP expression data across multiple patient cohorts?

When analyzing PTTG1IP expression across diverse patient cohorts, researchers should:

  • Normalize expression data appropriately to account for batch effects and technical variations

  • Use Student's t-test for two-sample comparisons with significance threshold of p<0.05

  • Present data as mean ± standard error for consistency with field standards

  • For larger datasets, employ Spearman's non-parametric correlation tests to evaluate relationships between variables like gene methylation and expression

  • Utilize advanced statistical packages such as R software (version 3.3.2 or later) for comprehensive analysis

For TCGA data analysis, accessing expression data (RNASeq) and DNA methylation data through platforms like cBioportal (www.cbioportal.org) ensures standardized approaches to large-scale genomic investigations .

What are the main challenges in developing targeted approaches against PTTG1IP?

Several challenges exist in developing effective targeted approaches against PTTG1IP:

  • Context-dependent expression patterns across different cancer types

  • Complex relationship with binding partner PTTG1, which may have opposing effects

  • Epigenetic regulation mechanisms that may vary between cancer subtypes

  • Limited understanding of structural determinants for protein-protein interactions

  • Potential post-translational modifications affecting function and localization

Researchers should consider these factors when designing studies aimed at therapeutic targeting of PTTG1IP or its pathway components.

What novel technologies show promise for elucidating PTTG1IP function?

Emerging technologies with significant potential for advancing PTTG1IP research include:

  • CRISPR-Cas9 genome editing for creating isogenic cell lines with PTTG1IP modifications

  • Single-cell RNA sequencing to understand expression heterogeneity within tumors

  • Proteomics approaches to identify the complete interactome of PTTG1IP

  • Advanced imaging techniques such as super-resolution microscopy for detailed localization studies

  • Patient-derived organoids for modeling PTTG1IP function in three-dimensional tissue contexts

These approaches can overcome limitations of traditional methods and provide deeper insights into PTTG1IP biology across different experimental and disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.