Recombinant Human Plasminogen receptor (KT) (C9orf46)

Shipped with Ice Packs
In Stock

Description

Biological Function

PLGRKT is a plasminogen receptor that enhances cell surface plasminogen activation, a process critical for thrombolysis, extracellular matrix remodeling, and inflammatory cell migration . Key functional insights include:

Mechanism of Action

  • Plasminogen Binding: The C-terminal lysine (K) of PLGRKT binds plasminogen via basic residues, facilitating its activation to plasmin .

  • Interaction Partners: Colocalizes with urokinase receptor (uPAR) and tissue plasminogen activator (t-PA), forming a pro-fibrinolytic complex .

  • Pathway Regulation: Promotes macrophage recruitment, MMP-2/9 activation, and catecholamine release in neuroendocrine cells .

Expression and Localization

PLGRKT mRNA is expressed in leukocytes, breast cancer cells, leukemic cells, and neuronal cells . Protein localization is primarily on the cell surface, with intracellular pools in certain contexts .

Binding Parameters

Studies using differentiated monocytes and Hoxa9-ER4 progenitor cells reveal saturable plasminogen binding:

Cell TypeApparent Kd (μM)Bmax (sites/cell)Source
M-CSF–treated Hoxa9-ER40.951.9 × 10⁵
M-CSF–treated monocytes0.579.1 × 10⁵

These values highlight PLGRKT’s high affinity for plasminogen .

Functional Assays

  • Peptide Competition: The C-terminal peptide CEQSKLFSDK (but not the reverse KDSFLKSQEC) inhibits plasminogen binding to PLGRKT .

  • t-PA Binding: PLGRKT directly interacts with t-PA, enhancing plasminogen activation .

Experimental Uses

  1. Antibody Blocking: The recombinant fragment (aa 76–147) is used as a control in Western blot (WB) and immunohistochemistry (IHC) to validate anti-PLGRKT antibodies (e.g., Abcam ab237525) .

  2. Cell Surface Studies: PLGRKT is employed to study plasminogen activation in macrophage migration and lipoprotein(a) uptake .

  3. Neuroendocrine Research: Investigates its role in catecholamine release and prohormone processing .

Antibodies and Tools

AntibodyApplicationSource
Abcam ab237525WB, IHC-P, ICC/IF
ThermoFisher PA5-98932WB, IHC
Rabbit PolyclonalBlocking assays

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped on blue ice packs by default. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PLGRKT; C9orf46; AD025; MDS030; Plasminogen receptor; KT; Plg-R(KT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PLGRKT
Target Protein Sequence
MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTF FGLAAISLTAGAIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSK LQLPRGMITFESIEKARKEQSRFFIDK
Uniprot No.

Target Background

Function

Plasminogen receptor (Plg-R, also known as C9orf46) is a receptor for plasminogen. It regulates urokinase plasminogen activator (uPA)-dependent and stimulates tissue-type plasminogen activator (tPA)-dependent cell surface plasminogen activation. It is proposed to be part of a local catecholaminergic cell plasminogen activation system that regulates neuroendocrine prohormone processing. Plg-R is also involved in regulating the inflammatory response by modulating monocyte chemotactic migration and the activation of matrix metalloproteinases, such as MMP2 and MMP9.

Gene References Into Functions
  1. Plg-R (KT) demonstrated high expression in bovine adrenomedullary chromaffin cells, human pheochromocytoma tissue, PC12 pheochromocytoma cells, and murine hippocampus. PMID: 21795689
  2. Plg-R (KT) plays a crucial role in plasminogen-dependent regulation of macrophage invasion, chemotactic migration, and recruitment during the inflammatory response. PMID: 21940822
Database Links

HGNC: 23633

KEGG: hsa:55848

STRING: 9606.ENSP00000223864

UniGene: Hs.584242

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in peripheral blood cells and monocytes. Expressed in adrenal medulla.

Q&A

What is Plasminogen receptor (KT) (C9orf46) and how was it discovered?

Plasminogen receptor KT (Plg-RKT) is a unique, 147-amino acid integral membrane protein that functions as a receptor for plasminogen, binding it through its C-terminal lysine residue. Unlike previously characterized plasminogen receptors, Plg-RKT is synthesized exclusively as a cell surface protein specifically designed to bind plasminogen.

It was first identified in 2009 through proteomics-based discovery using multidimensional protein identification technology on differentiated mouse macrophages . The researchers used an inducible progenitor cell line (Hoxa9-ER4) to identify this novel differentiation-induced integral membrane plasminogen receptor that exposes a C-terminal lysine on the cell surface . The isolation of peptides corresponding to C9orf46 homolog represented the first demonstration of the existence of this protein .

Plg-RKT is highly conserved across mammalian species with homologs also found in Xenopus, Drosophila, and zebrafish. Importantly, all mammalian orthologs of Plg-RKT contain the characteristic C-terminal lysine residue essential for plasminogen binding .

What is the structural organization of Plg-RKT and how does it function on the cell surface?

Plg-RKT is a structurally unique plasminogen receptor with 147 amino acids that functions as an integral membrane protein. Its most distinctive structural feature is the C-terminal lysine residue that extends to the extracellular space, which is critical for binding plasminogen . This C-terminal lysine is conserved across all mammalian Plg-RKT orthologs, highlighting its functional importance .

On the cell surface, Plg-RKT is highly colocalized with the urokinase receptor (uPAR) . This strategic colocalization facilitates efficient plasminogen activation. Functionally, Plg-RKT operates through two key mechanisms:

  • Direct plasminogen binding: It captures plasminogen at the cell surface through its C-terminal lysine domain.

  • Coordination with plasminogen activators: It also interacts directly with tissue plasminogen activator (tPA) through the same C-terminal lysine domain .

This dual binding capacity allows Plg-RKT to enhance plasminogen activation significantly by bringing plasminogen and its activators into close proximity on the cell surface .

How does Plg-RKT enhance plasminogen activation compared to other plasminogen receptors?

Plg-RKT enhances plasminogen activation through several distinct mechanisms that differentiate it from other plasminogen receptors:

  • Dual binding capability: Unlike many other plasminogen receptors, Plg-RKT not only binds plasminogen but also directly interacts with tissue plasminogen activator (tPA) through its C-terminal lysine domain. This dual binding capability creates a highly efficient local environment for plasminogen activation .

  • Strategic colocalization: Plg-RKT is clustered on the cell surface with urokinase-type plasminogen activator (uPA) when the latter is bound to its receptor uPAR. This colocalization of plasminogen and its activators is a key mechanism by which Plg-RKT regulates cell surface-associated plasmin generation .

  • Exclusive membrane localization: Unlike other plasminogen receptors that may have dual intracellular and extracellular functions (such as α-enolase, cytokeratin 8, or histone H2B), Plg-RKT is present exclusively on the cell surface as an integral membrane protein, making it specifically dedicated to its role in plasminogen activation .

  • High specificity: The binding parameters for plasminogen on differentiated cells expressing Plg-RKT are optimal for physiological function, with an apparent Kd of 0.95 μM and approximately 1.9 × 10^5 binding sites per cell in M-CSF-differentiated Hoxa9-ER4 cells .

This combination of features makes Plg-RKT particularly effective at promoting localized plasmin generation at the cell surface.

What phenotypes are observed in Plg-RKT knockout mice and what do they reveal about its function?

Plg-RKT knockout (Plg-RKT^-/-) mice have revealed several important and sometimes unexpected phenotypes that provide insights into both plasmin-dependent and plasmin-independent functions:

  • Viability: Unlike plasminogen-deficient mice which develop multiple spontaneous pathologies, Plg-RKT^-/- mice are viable and largely phenotype-free under baseline conditions, suggesting that Plg-RKT is not essential for all plasminogen functions .

  • Lactation deficiency: Female Plg-RKT^-/- mice exhibit a severe defect in lactation, with diminished milk production despite normal mammary gland development during pregnancy. Intriguingly, this phenotype is more severe than that observed in plasminogen-deficient mice, suggesting a plasminogen-independent role for Plg-RKT in mammary gland function .

  • Reduced inflammatory response: Plg-RKT^-/- mice show an approximately 80% reduction in macrophage recruitment to the peritoneal cavity in the thioglycollate model of inflammation, consistent with Plg-RKT's high expression in proinflammatory macrophages .

  • Absence of spontaneous fibrin deposition: Unlike mice deficient in other plasminogen receptors (such as annexin A2-S100A10), Plg-RKT^-/- mice do not display increased microvascular fibrin deposition in multiple organs, suggesting that Plg-RKT may not play a central role in baseline plasmin-mediated fibrin surveillance and clearance .

  • Mild dermatitis: A modest increase in dermatitis was reported in Plg-RKT^-/- mice, although this may be influenced by the C57Bl/6 background strain's inherent susceptibility to dermatitis .

These phenotypes suggest that Plg-RKT has both overlapping and distinct functions compared to other plasminogen receptors, with particularly important roles in inflammatory cell recruitment and mammary gland function that may extend beyond its role in plasminogen activation.

What methodologies are recommended for studying Plg-RKT expression and function in experimental models?

For comprehensive investigation of Plg-RKT, researchers should employ multiple complementary methodologies:

Expression Analysis:

  • Antibody-based detection: Use both polyclonal and monoclonal antibodies against Plg-RKT for immunoblotting, immunohistochemistry, and flow cytometry. Antibodies raised against the synthetic peptide CEQSKLFSDK (corresponding to the C-terminal region) have proven effective .

  • Flow cytometry: For cell surface expression analysis, fluorescence-activated cell sorting (FACS) with specific anti-Plg-RKT antibodies followed by detection with appropriate secondary antibodies (e.g., Alexa 488-F(ab′)2 of goat anti-rabbit IgG) allows quantification of receptor density .

  • Immunofluorescence microscopy: For colocalization studies with other receptors such as uPAR, use dual-labeling techniques with appropriate fluorophore-conjugated secondary antibodies (e.g., Alexa 488 and Alexa 568 F(ab′)2 fragments) .

Functional Analysis:

  • Binding assays: To assess plasminogen binding, use either:

    • Solid-phase binding assays with the C-terminal peptide of Plg-RKT (CEQSKLFSDK coupled to BSA) and detection with anti-plasminogen antibodies

    • Cell-based binding assays using labeled plasminogen and flow cytometry analysis

  • Plasminogen activation assays: Monitor the generation of plasmin using chromogenic or fluorogenic substrates in the presence of purified Plg-RKT or Plg-RKT-expressing cells .

  • Cell migration assays: For studying the role of Plg-RKT in macrophage recruitment and migration, use modified Boyden chamber assays or real-time cell migration tracking systems .

Genetic Models:

  • Knockout mice: Plg-RKT^-/- mice serve as valuable tools for in vivo analysis, particularly for studying inflammation, macrophage function, and mammary gland development .

  • Cell differentiation models: The Hoxa9-ER4 cell line provides a useful model for studying Plg-RKT expression during monocyte/macrophage differentiation when treated with M-CSF .

  • siRNA knockdown: For acute depletion studies in cell culture systems, use RNA interference targeting Plg-RKT .

These methodologies should be selected based on the specific research question while considering appropriate controls, particularly for distinguishing Plg-RKT-specific effects from those of other plasminogen receptors.

How does Plg-RKT interact with the broader plasminogen activation system in inflammation?

Plg-RKT serves as a key orchestrator of plasminogen activation during inflammation through multiple coordinated interactions:

  • Regulation of plasminogen receptor expression: Inflammatory stimuli increase the surface expression of several plasminogen receptors, including Plg-RKT, annexin A2-S100A10, enolase-1, and histone 2B . This upregulation enhances the cell's capacity for plasminogen binding and subsequent activation.

  • Macrophage recruitment: Plg-RKT plays a critical role in inflammatory macrophage recruitment, as evidenced by the ~80% reduction in macrophage infiltration observed in Plg-RKT^-/- mice in response to thioglycollate challenge . This significantly exceeds the reduction seen with antibody blockade (~49%), suggesting that genetic deletion has more profound effects.

  • Coordination with plasminogen activators: At inflammatory sites, Plg-RKT colocalizes with uPAR and directly interacts with tPA, creating localized activation complexes that efficiently generate plasmin . This spatial organization allows for targeted proteolytic activity.

  • Regulation of matrix metalloproteinase activation: Plg-RKT regulates the activation of matrix metalloproteinases, including MMP2 and MMP9 , which are crucial for cell migration through extracellular matrix barriers during inflammation.

  • Potential role in fibrinolysis at inflammatory sites: While Plg-RKT^-/- mice do not show spontaneous fibrin deposition, Plg-RKT may still contribute to clearing inflammation-associated pathological fibrin deposits, which are nearly universal features of inflammatory foci .

  • Specialized inflammatory contexts: Plg-RKT may have tissue-specific roles in inflammation, particularly in contexts where macrophages are key mediators, such as microglial cells in neuroinflammatory disease, Kupffer cells in hepatotoxic injury, and M1-type adipose tissue macrophages in obesity .

The unique position of Plg-RKT as an integral membrane protein dedicated to plasminogen binding and activation makes it a potentially attractive therapeutic target for modulating inflammatory responses in pathological conditions.

What techniques are effective for detecting and quantifying Plg-RKT expression in tissue samples?

Researchers investigating Plg-RKT expression in tissue samples should consider these optimized technical approaches:

Immunohistochemistry/Immunofluorescence:

  • Antibody selection: Use validated antibodies specifically targeting Plg-RKT, such as those raised against the synthetic peptide CEQSKLFSDK . Both polyclonal (rabbit) and monoclonal (rat/mouse) antibodies have proven effective.

  • Tissue preparation: For formalin-fixed paraffin-embedded (FFPE) tissues, standard antigen retrieval methods are recommended, with citrate buffer (pH 6.0) being most effective for preserving Plg-RKT epitopes.

  • Detection systems: For co-localization studies with other markers, use multi-color immunofluorescence with appropriate secondary antibodies (e.g., Alexa 488-F(ab′)2 for Plg-RKT detection) .

Western Blotting:

  • Sample preparation: Use membrane-enriched fractions for optimal detection of Plg-RKT, as it's an integral membrane protein.

  • Protein separation: Standard SDS-PAGE conditions with 12-15% polyacrylamide gels are appropriate for resolving the approximately 17 kDa Plg-RKT protein.

  • Transfer and detection: PVDF membranes and enhanced chemiluminescence systems provide good sensitivity for Plg-RKT detection.

Flow Cytometry:

  • Cell preparation: Use gentle enzymatic dissociation methods to preserve cell surface proteins when preparing single-cell suspensions from tissues.

  • Antibody staining: Employ direct or indirect staining protocols with fluorophore-conjugated anti-Plg-RKT antibodies.

  • Multi-parameter analysis: Combine Plg-RKT staining with lineage markers (e.g., F4/80 for macrophages) to identify specific cell populations expressing the receptor .

mRNA Analysis:

  • RT-PCR/qPCR: Design primers specific to Plg-RKT coding sequences, considering species-specific sequence variations.

  • In situ hybridization: For spatial localization of Plg-RKT mRNA expression within intact tissue architecture.

Controls and Validation:

  • Positive controls: Use tissues known to express Plg-RKT, such as spleen or macrophage-rich tissues.

  • Negative controls: Tissues from Plg-RKT knockout mice provide ideal negative controls for antibody specificity validation .

  • Blocking peptides: Use the C-terminal peptide (CEQSKLFSDK) as a competitive inhibitor to confirm antibody specificity.

These technical approaches should be tailored to the specific research question and tissue type being investigated while maintaining appropriate controls to ensure specificity and reproducibility.

How can researchers differentiate between Plg-RKT-mediated effects and those of other plasminogen receptors?

Distinguishing Plg-RKT-specific functions from those of other plasminogen receptors requires strategic experimental approaches:

Molecular Targeting Strategies:

Genetic Approaches:

  • Knockout models: Compare phenotypes between Plg-RKT^-/- mice and knockout models of other plasminogen receptors (e.g., annexin A2, S100A10) to identify unique versus overlapping functions .

  • RNA interference: Use siRNA or shRNA specifically targeting Plg-RKT in cell culture systems, with appropriate scrambled or non-targeting controls .

  • Receptor rescue experiments: In Plg-RKT-deficient cells, perform selective re-expression of Plg-RKT or other plasminogen receptors to determine specific contributions.

Functional Assessment:

  • Binding kinetics analysis: Compare the binding parameters (Kd, Bmax) of plasminogen to cells expressing different plasminogen receptors. For Plg-RKT-expressing cells, the parameters are approximately Kd = 0.95 μM and Bmax = 1.9 × 10^5 sites/cell .

  • Activation complex formation: Assess colocalization of plasminogen activators (tPA, uPA) with different receptors, as Plg-RKT uniquely colocalizes with uPAR and directly binds tPA .

  • Plasmin-independent effects: Examine phenotypes in contexts where plasminogen is also deficient to identify receptor functions independent of plasminogen binding (e.g., the more severe lactation defect in Plg-RKT^-/- mice compared to Plg^-/- mice) .

By employing these approaches, researchers can systematically delineate the specific contributions of Plg-RKT to cellular processes while accounting for the functional redundancy and overlap within the plasminogen receptor family.

What is the role of Plg-RKT in pathological processes and disease models?

Plg-RKT has emerging roles in multiple pathological contexts, with varying levels of experimental evidence:

Inflammatory Diseases:

  • Macrophage-mediated inflammation: Given that Plg-RKT^-/- mice show an approximately 80% reduction in macrophage recruitment in inflammatory models, Plg-RKT likely plays significant roles in diseases where macrophage infiltration is a key pathogenic mechanism . These may include:

    • Rheumatoid arthritis

    • Atherosclerosis

    • Inflammatory bowel disease

    • Neuroinflammatory conditions

  • Autoimmune conditions: Several plasminogen receptors, including annexin A2, enolase-1, and histone 2B, are targets of autoantibodies in autoimmune diseases. While not yet conclusively demonstrated for Plg-RKT, its role as a plasminogen receptor suggests similar potential in autoimmune pathology .

Cancer:

  • Tumor progression: Plg-RKT is upregulated in many tumor types, suggesting a potential role in cancer progression. The plasminogen activation system and macrophages are both implicated in tumor development .

  • Metastasis: By facilitating pericellular proteolysis through plasmin generation, Plg-RKT may contribute to extracellular matrix degradation, a critical step in tumor invasion and metastasis.

  • Tumor-associated macrophages: Plg-RKT may function in cancer through mechanisms linked to M2-type tumor-promoting macrophages, which promote angiogenesis and immunosuppression .

Other Pathologies:

  • Fibrin-associated disorders: While Plg-RKT^-/- mice don't show spontaneous fibrin deposition like other plasminogen receptor knockout models, Plg-RKT may still contribute to pathological fibrinolysis in specific contexts .

  • Tissue remodeling disorders: Through regulation of matrix metalloproteinase activation (MMP2 and MMP9), Plg-RKT may influence pathological tissue remodeling in conditions such as fibrosis or destructive inflammatory diseases .

  • Bacterial infections: The plasminogen system is exploited by many pathogenic bacteria to facilitate tissue invasion. Plg-RKT's role in this process remains to be fully elucidated.

The ability of Plg-RKT^-/- mice to survive without spontaneous pathologies under baseline conditions suggests that pharmacological targeting of Plg-RKT might have a favorable side effect profile compared to broader inhibition of the plasminogen system, making it an attractive potential therapeutic target .

What are the current challenges and future directions in Plg-RKT research?

Researchers face several key challenges and opportunities in advancing Plg-RKT research:

Technical Challenges:

  • Receptor specificity: Distinguishing Plg-RKT-specific effects from those of other plasminogen receptors remains difficult due to overlapping expression patterns and redundant functions .

  • Structural characterization: Detailed structural information about Plg-RKT, particularly its membrane topology and protein-protein interaction interfaces, is still limited.

  • Context-dependent regulation: Understanding how Plg-RKT expression and function are regulated in different tissue microenvironments requires more sophisticated models.

Emerging Research Directions:

  • Plasminogen-independent functions: The more severe mammary gland phenotype in Plg-RKT^-/- mice compared to Plg^-/- mice suggests Plg-RKT may interact with other proteins or function in other pathways. Identifying these novel interactions is a priority .

  • Cell-type specific functions: While highly expressed in macrophages, Plg-RKT is present in many cell types. Developing cell-type specific knockout models would help delineate its function in different contexts.

  • Therapeutic targeting potential: As Plg-RKT^-/- mice are viable and largely phenotype-free under normal conditions, pharmacological targeting of Plg-RKT in pathological contexts represents an attractive therapeutic strategy that warrants further investigation .

  • Interaction with other membrane proteins: Exploring potential interactions with other cell surface molecules such as β1 integrin and connexin 43, which when deficient produce similar mammary gland defects as Plg-RKT^-/- mice, may reveal new functional complexes .

  • Role in specialized tissue microenvironments: Investigating Plg-RKT function in contexts such as:

    • Microglial cells in neuroinflammatory disease

    • Kupffer cells in hepatotoxic injury

    • M1-type adipose tissue macrophages in obesity

    • Tumor-associated macrophages in cancer microenvironments

Methodological Innovations Needed:

  • Better tools for receptor visualization: Development of improved antibodies, fluorescent probes, or reporter systems to monitor Plg-RKT dynamics in living cells and tissues.

  • Systems biology approaches: Integration of proteomics, transcriptomics, and functional data to place Plg-RKT in broader cellular signaling networks.

  • Conditional knockout models: Generation of inducible and cell-type specific Plg-RKT knockout mice to overcome potential developmental compensation.

Advancing these research directions will provide deeper insights into the biological functions of Plg-RKT and potentially identify new therapeutic opportunities for inflammatory diseases, cancer, and other pathologies where the plasminogen activation system plays a key role.

What experimental systems are most suitable for studying Plg-RKT function in vitro?

Several experimental systems offer advantages for investigating specific aspects of Plg-RKT biology:

Cell Line Models:

  • Hoxa9-ER4 progenitor cell line: This estrogen-regulated conditional system allows controlled differentiation to monocytes/macrophages and shows induction of Plg-RKT expression during differentiation, making it ideal for studying regulation of Plg-RKT expression . Methodology includes:

    • Removal of estrogen from medium to inactivate Hoxa9-ER protein

    • Treatment with M-CSF (murine M-CSF or conditioned media from LADMAC cells) to induce differentiation

    • Monitoring of differentiation markers (CD antigens) by flow cytometry

  • Primary human monocytes/macrophages: These provide a physiologically relevant system for studying endogenous Plg-RKT. Isolation involves:

    • Separation of mononuclear cells from peripheral blood

    • Plating onto tissue culture dishes for monocyte adherence

    • Differentiation with human recombinant M-CSF

  • Cell lines with varied Plg-RKT expression: Breast cancer, leukemic, and neuronal cell lines expressing different levels of Plg-RKT mRNA allow comparative studies of receptor function in different cellular contexts .

Biochemical and Binding Assays:

  • Solid-phase binding assays: For mechanistic studies of Plg-RKT interaction with plasminogen and tPA:

    • Coat microtiter plates with C-terminal peptide of Plg-RKT (CEQSKLFSDK coupled to BSA)

    • Block with BSA

    • Incubate with Glu-plasminogen or Lys-plasminogen

    • Detect binding with specific antibodies and appropriate secondary detection systems

  • Cell surface plasminogen activation assays: For measuring functional outcomes:

    • Incubate cells with plasminogen and plasminogen activators

    • Measure plasmin generation using chromogenic substrates

    • Include specific inhibitors to distinguish Plg-RKT-dependent activation

Genetic Manipulation Systems:

  • RNA interference: For acute depletion of Plg-RKT:

    • Transfect cells with specific siRNAs targeting Plg-RKT

    • Validate knockdown at protein and mRNA levels

    • Assess functional consequences in binding and activation assays

  • CRISPR/Cas9 genome editing: For complete knockout or targeted mutation:

    • Design guide RNAs targeting the Plg-RKT gene

    • Screen and validate clones for complete loss of expression

    • Perform rescue experiments with wild-type or mutant Plg-RKT to confirm specificity

Co-culture Systems:

  • Macrophage-tumor cell co-cultures: To investigate Plg-RKT's role in tumor-macrophage interactions.

  • Inflammatory cell recruitment models: To study Plg-RKT's role in chemotactic migration.

These experimental systems should be selected based on the specific research question while including appropriate controls to account for potential compensation by other plasminogen receptors.

What analytical techniques provide the most reliable quantification of Plg-RKT-dependent plasminogen activation?

For precise quantification of Plg-RKT-dependent plasminogen activation, researchers should consider these optimized analytical approaches:

Chromogenic/Fluorogenic Substrate Assays:

  • Real-time kinetic measurements: Monitor plasmin generation continuously using specific chromogenic (e.g., S-2251) or fluorogenic substrates with the following modifications for Plg-RKT specificity:

    • Pre-treatment with anti-Plg-RKT antibodies versus control IgG

    • Inclusion of Plg-RKT blocking peptide (CEQSKLFSDK) versus control peptide (e.g., KDSFLKSQEC)

    • Comparative analysis using cells from Plg-RKT^-/- versus wild-type mice

  • Data analysis parameters:

    • Calculate initial reaction velocities (V0) from the linear portion of the progress curve

    • Determine kinetic parameters (Km, Vmax) using varying concentrations of plasminogen

    • Express results as percentage of control to normalize for variations between experimental batches

Cell-Based Activation Systems:

  • Flow cytometry-based detection:

    • Incubate cells with fluorescently labeled plasminogen

    • Add plasminogen activators (tPA or uPA)

    • Measure cell-associated fluorescence as an indicator of bound plasminogen/plasmin

    • Use carboxypeptidase B treatment as a control to remove all C-terminal lysine-dependent binding

  • Cell surface plasmin retention assay:

    • Generate plasmin on the cell surface using purified components

    • Wash cells to remove unbound plasmin

    • Measure cell-associated plasmin activity using chromogenic substrates

    • Compare activity in the presence of Plg-RKT inhibitors or genetic depletion

Comparative Receptor Analysis:

  • Receptor competition experiments:

    • Compare plasminogen activation in the presence of specific inhibitors for different plasminogen receptors

    • Use a matrix experimental design to identify additive, synergistic, or redundant effects

    • Calculate the relative contribution of Plg-RKT to total cell surface plasminogen activation

  • Binding parameter determination:

    • Measure binding isotherms for plasminogen on cells expressing or lacking Plg-RKT

    • Calculate apparent Kd and Bmax values using saturation binding analysis

    • For Plg-RKT-expressing cells, typical values are: apparent Kd = 0.95 μM and Bmax = 1.9 × 10^5 sites/cell

Imaging-Based Analysis:

  • Confocal microscopy with activity-based probes:

    • Use fluorescent activity-based probes that become activated upon plasmin generation

    • Perform colocalization analysis with labeled Plg-RKT and plasminogen activators

    • Quantify signal intensity as a measure of localized activation

These analytical techniques should be calibrated using appropriate standards and controls, with results expressed in standardized units to facilitate comparison across different experimental systems and laboratories.

How might targeting Plg-RKT be developed as a therapeutic strategy?

The unique properties of Plg-RKT and the viability of Plg-RKT^-/- mice under baseline conditions suggest several promising therapeutic approaches:

Targeting Strategies:

  • Blocking antibodies: Develop therapeutic antibodies against the C-terminal region of Plg-RKT (CEQSKLFSDK) to prevent plasminogen binding . Advantages include:

    • High specificity compared to broader plasminogen system inhibitors

    • Potential for tissue-targeted delivery using bispecific antibody approaches

    • Precedent from experimental models where antibody blockade reduced macrophage recruitment by 49%

  • Competitive peptide inhibitors: Design peptide or peptidomimetic compounds based on the C-terminal sequence of Plg-RKT that can compete for plasminogen binding without activating it . Consider:

    • Modified peptides with enhanced stability and cell permeability

    • Cyclized peptides to increase binding affinity

    • Peptide-drug conjugates for targeted delivery

  • Small molecule inhibitors: Develop small molecules that bind to the C-terminal lysine recognition site on plasminogen, preventing its interaction with Plg-RKT. This approach offers:

    • Better pharmacokinetic properties than peptides

    • Potential for oral bioavailability

    • Lower production costs

Therapeutic Applications:

  • Inflammatory diseases: Target conditions where macrophage recruitment plays a central role in pathogenesis :

    • Rheumatoid arthritis

    • Inflammatory bowel disease

    • Atherosclerosis

    • Neuroinflammatory conditions

  • Cancer: Investigate applications in tumors where Plg-RKT is upregulated and may contribute to invasion and metastasis :

    • Target tumor cells directly to reduce plasmin-mediated matrix degradation

    • Target tumor-associated macrophages to modify the tumor microenvironment

  • Combination strategies: Develop approaches that combine Plg-RKT inhibition with:

    • Conventional anti-inflammatory agents for synergistic effects

    • Chemotherapy to enhance efficacy through modulation of the tumor microenvironment

    • Other plasminogen system inhibitors for more complete pathway blockade

Development Considerations:

  • Therapeutic window: The lack of spontaneous pathologies in Plg-RKT^-/- mice suggests a favorable safety profile compared to broader inhibition of the plasminogen system .

  • Tissue specificity: Consider developing tissue-targeted delivery strategies to focus inhibition on relevant cell types (e.g., inflammatory macrophages).

  • Biomarker development: Identify patient populations most likely to benefit using biomarkers of Plg-RKT expression or activity.

  • Potential limitations: Address concerns including potential interference with normal wound healing processes and the possibility of compensatory upregulation of other plasminogen receptors.

The selective nature of Plg-RKT inhibition, targeting a specific component of the plasminogen activation system rather than broadly inhibiting plasmin generation, represents a novel and potentially safer approach to modulating plasmin-dependent pathological processes.

What is known about Plg-RKT's contribution to mammary gland function and lactation?

The unexpected lactation defect in Plg-RKT^-/- female mice has revealed important insights into mammary gland biology:

Phenotypic Observations:

  • Lactation failure: Female Plg-RKT^-/- mice exhibit severe defects in lactation with diminished milk production despite normal mammary gland development during pregnancy .

  • Severity comparison: Notably, this lactation defect is more severe than that observed in plasminogen-deficient (Plg^-/-) mice, suggesting that Plg-RKT has functions in mammary gland biology that extend beyond plasminogen binding and activation .

Molecular Mechanisms:

  • Plasminogen-independent pathways: The more severe phenotype in Plg-RKT^-/- compared to Plg^-/- mice suggests Plg-RKT may interact with other proteins or signaling pathways in mammary epithelial cells .

  • Potential interactions: Plg-RKT may function in concert with other cell surface or integral membrane proteins important for mammary gland development and function. Two candidates with similar phenotypes when deficient include:

    • β1 integrin: Mammary epithelial cell-specific deletion results in lactation defects

    • Connexin 43: A gap junction protein whose deficiency leads to similar mammary gland defects with diminished milk production

  • Alternative ligands: Plg-RKT may serve as a receptor for a second, as yet unidentified, protease that functions to modify the extracellular matrix during mammary gland development .

Research Implications:

  • New biological roles: This phenotype reveals unexpected functions of Plg-RKT beyond inflammation and macrophage recruitment, expanding its biological significance.

  • Developmental biology: Plg-RKT may play important roles in tissue development and remodeling that have not been previously appreciated.

  • Cell-cell communication: The similar phenotypes between Plg-RKT^-/- mice and connexin 43-deficient mice suggest potential roles in cell-cell communication or coordination of epithelial cell function.

The precise cellular and molecular basis of lactation incompetence in Plg-RKT^-/- mice remains to be established, representing an important area for future research that may reveal novel functions of this unique receptor beyond its established role in plasminogen activation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.