Recombinant Human Platelet-activating factor receptor (PTAFR)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Recombinant Human Platelet-Activating Factor Receptor (PTAFR) is a genetically engineered form of the G protein-coupled receptor (GPCR) that binds platelet-activating factor (PAF), a phospholipid mediator involved in inflammatory and immune responses . PTAFR plays critical roles in pathologies such as sepsis, asthma, atherosclerosis, and cancer by regulating leukocyte activation, vascular permeability, and cytokine release . The recombinant form enables precise study of receptor-ligand interactions and therapeutic targeting.

Research Applications

Recombinant PTAFR is instrumental in:

  • Drug discovery: Screening antagonists like apafant (WEB-2086) and rupatadine .

  • Inflammation studies: Investigating PAF’s role in neutrophil chemotaxis, mast cell activation, and macrophage polarization .

  • Cancer research: Topical PAF-R agonists suppress phorbol ester-induced tumorigenesis in murine models .

Key Findings from Preclinical Studies

  • Anti-inflammatory effects: Recombinant PAF acetylhydrolase (rPAF-AH) reduces neutrophil apoptosis and chemotaxis but failed to improve sepsis survival in clinical trials .

  • Chemoprevention: Topical carbamoyl-PAF (CPAF) decreased tumor burden by 60% in DMBA/PMA-induced skin carcinogenesis models .

Clinical Trials with PTAFR-Targeted Therapies

Study FocusOutcomeSource
Severe sepsisrPAF-AH (1.0 mg/kg) showed no mortality benefit vs. placebo (25% vs. 24%) Phase III trial
Chronic inflammationCPAF suppressed PMA-induced ear swelling and granulocytic infiltration Murine model

Mechanistic Insights

  • PAF-R desensitization: Chronic CPAF application downregulates receptor signaling, reducing hyperplastic responses .

  • Mast cell dependency: Anti-inflammatory effects of CPAF require c-Kit signaling, implicating mast cells in PAF-R modulation .

Challenges and Limitations

  • Therapeutic complexity: Despite preclinical success, systemic PAF-R modulation risks paradoxical effects due to ligand-induced receptor desensitization .

  • Species specificity: Murine models show divergent PAF-R signaling compared to humans, complicating translational research .

Future Directions

  • Targeted delivery: Nanoparticle-based PAF-R agonists/antagonists to minimize off-target effects .

  • Combination therapies: Pairing PAF-R inhibitors with checkpoint blockers in cancer immunotherapy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PTAFR; PAFR; Platelet-activating factor receptor; PAF-R; PAFr
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
Uniprot No.

Target Background

Function
The platelet-activating factor receptor (PAFR) is a receptor for platelet-activating factor (PAF), a potent phospholipid mediator with inflammatory, smooth muscle contractile, and hypotensive effects. PAFR appears to mediate its effects through a G protein-coupled mechanism activating a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. PAFR gene polymorphisms (rs5938 or rs313152) may serve as biomarkers for coronary heart disease susceptibility. PMID: 28197937
  2. Weighted gene co-expression network analysis identified PAFR and FGR as key hub genes predicting esophageal cancer patient survival. PMID: 28585144
  3. PAFR inhibition selectively enhances radiotherapy sensitivity in prostate cancer cells with elevated PAFR expression. PMID: 28099922
  4. PAFR overexpression is associated with pneumococcal infection. PMID: 28278175
  5. WEB-2086, a novel drug candidate, inhibits PAFr-dependent lung infections in smoking-related COPD. PMID: 27524890
  6. PAF stimulation promotes prostate cancer cell invasion, migration, and growth in vitro, potentially through ERK1/2 pathway activation, increased MMP-3 expression, and decreased E-cadherin expression. PMID: 27176648
  7. PAFR overexpression is observed in NSCLC, breast, colorectal, and gastric carcinomas, correlating with clinical stage, survival, and metastasis. PAF/PAFR signaling upregulates IL6 and activates STAT3. PMID: 26359459
  8. PAFR dysregulation and the PAFR-pAKT positive regulatory loop contribute to esophageal squamous cell carcinoma progression. PMID: 25639872
  9. PAFR plays a significant role in tumor growth, potentially by modulating macrophage phenotype and function. PMID: 25182608
  10. Epithelial PAFR expression is elevated in smokers, particularly those with COPD, and is not significantly affected by inhaled corticosteroids. PMID: 25143722
  11. WEB2086 and AG1478 show synergistic effects in ovarian cancer cells with high PAFR and EGFR expression. PMID: 24886678
  12. PAFR may influence cisplatin sensitivity in ovarian cancer cells. PMID: 24921917
  13. Elevated PAFR expression is associated with significantly longer survival times in certain patient populations. PMID: 24824933
  14. oxLDL induces PAFR and CD36 colocalization in lipid rafts, affecting oxLDL uptake and IL-10 production. PMID: 24130805
  15. PAF/PAFR signaling exerts proinflammatory effects on neutrophils by downregulating LXRa and its target genes (ABCA1, ABCG1, SREBP1c). PMID: 24289152
  16. Lipoteichoic acid inhibits platelet aggregation through PAFR, as demonstrated by blocking with anti-PafR antibody and Ginkgolide B. PMID: 23911710
  17. oxLDL induces alternative macrophage activation through CD36 and PAFR. PMID: 24062612
  18. PAFR and SIRT1 expression is downregulated in endothelial progenitor cells of type 2 diabetic patients with poor glycemic control. PMID: 23070058
  19. The PAFR A224D mutation may be associated with relapsing-remitting multiple sclerosis susceptibility. PMID: 21658861
  20. Phagocytic recognition of apoptotic cells activates PAFR pathways, creating a microenvironment favorable to melanoma growth. PMID: 22577252
  21. PAFR may play a role in tumor response mechanisms to chemotherapeutic agents. PMID: 22570511
  22. Eosinophils use PAFRs to interact with Staphylococcus aureus. PMID: 22595142
  23. Elevated keratin 10, laminin receptor, and PAFR in aged lungs contribute to increased pneumonia susceptibility. PMID: 21615674
  24. Urban particulate matter increases S. pneumoniae adhesion to airway epithelial cells via oxidative stress and PAFR. PMID: 21247619
  25. PAF promotes oxLDL-induced recruitment of hBMSCs through PAFR-dependent MAPK activation. PMID: 21063106
  26. PAFR expression in early endothelial progenitor cells and PAF release under endothelial dysfunction conditions were investigated. PMID: 20637897
  27. Some Gram-positive bacteria utilize HIF-1α-regulated PAFR for translocation through intestinal epithelial cells. PMID: 20032301
  28. PAFR's role in PAF-mediated mast cell activation. PMID: 20392487
  29. A conserved proline in TM6 is crucial for PAFR intracellular trafficking. PMID: 20007715
  30. PAFR activates ERK MAPK and induces epidermal cell proliferation. PMID: 11861812
  31. An inverse relationship exists between neuroblastoma cell invasiveness, differentiative capacity, and cell surface PAF receptor expression. PMID: 11928813
  32. PAFR transcript splice variants were identified in human cancer cell lines. PMID: 12467527
  33. Epidermal PAFR augments chemotherapy-induced apoptosis through an NF-κB-dependent mechanism. PMID: 12601006
  34. Epidermal PAFR modulates staphylococcal alpha-toxin signaling. PMID: 12713583
  35. Coumermycin-gyrase B-induced dimerization desensitizes and internalizes PAFR. PMID: 12756251
  36. PAFR degradation occurs through proteasomal and lysosomal pathways, with ligand-stimulated degradation being ubiquitin-dependent. PMID: 14500726
  37. PAFR-mediated signaling is crucial for endothelial cell functions, including cell migration and MMP2 activation. PMID: 14617636
  38. Oxidized low-density lipoproteins induce increased uPA monocyte expression and chemokine release, potentially through PAFR-mediated pathways. PMID: 15149885
  39. Significant variations in membrane PAFR expression were observed in B-CLL patients, potentially linked to plasma IL-4 levels. PMID: 15160913
  40. A PAFR gene missense mutation is associated with multiple sclerosis susceptibility. PMID: 15748960
  41. UVB photo-oxidizes cellular phospholipids, generating PAF analogs that stimulate PAFR, leading to further PAF synthesis and apoptosis. PMID: 16115894
  42. PAF induces CREB and ATF-1 phosphorylation via a PAFR-mediated pathway involving Gαq protein, adenylate cyclase, and PKA/p38 MAPK modulation. PMID: 16306050
  43. Functional PAFR in arterial smooth muscle cells may contribute to atherosclerosis. PMID: 16793019
  44. Functional PAFR is present in acute leukemia blast cells, potentially influencing leukocyte maturation and function. PMID: 16837045
  45. Sebocytes express functional PAFRs, which regulate inflammatory mediators (COX-2, PGE2, IL-8). PMID: 16984258
  46. Epidermal PAFR modulates UVB-mediated early gene expression. PMID: 17928889
  47. Lower PAFR expression in HCC correlates with poor differentiation and portal venous invasion. PMID: 18187960
  48. PAFR activation and its pleiotropic effects on tyrosine phospho-EGFR/Src/FAK/paxillin in ovarian cancer. PMID: 18632638
  49. cis-urocanic acid stimulates mediator production independently of serotonin 2A and PAF receptors in human keratinocytes. PMID: 19474802
  50. PAFR localizes to lipid rafts/caveolae, crucial for downstream signaling. PMID: 19620302
Database Links

HGNC: 9582

OMIM: 173393

KEGG: hsa:5724

STRING: 9606.ENSP00000301974

UniGene: Hs.77542

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the placenta, lung, left and right heart ventricles, heart atrium, leukocytes and differentiated HL-60 granulocytes.

Q&A

What is the molecular structure of human PTAFR and how does it function?

Human PTAFR is a G protein-coupled receptor consisting of seven transmembrane domains with both extracellular and intracellular domains. It functions by binding platelet-activating factor (PAF), a potent bioactive phospholipid, triggering intracellular signaling cascades. The receptor primarily couples to the G proteins of both Gq and Gi classes, activating phospholipase Cβ and inducing secondary messengers including inositol (1,4,5)-trisphosphate and diacyl glycerol . This activation results in calcium mobilization in neutrophils and other cellular responses. The receptor also mediates chemotactic and cross-regulatory signals through its coupling with the Gi class of G proteins, contributing to exocytosis in cellular systems . The C-terminal tail of the receptor contains determinants that are important for endocytosis, as demonstrated by mutation studies showing that truncation at Cys317 significantly reduces receptor internalization .

What is the relationship between PAF, lysoPAF, and the platelet-activating factor receptor?

PAF activates multiple cells and tissues by binding to PTAFR, while lysoPAF (1-O-hexadecyl-2-hydroxy-sn-glycero-3-phosphocholine) serves as both a precursor and metabolite of PAF. PAF is rapidly generated via enzymatic acetylation of lysoPAF and is not stored in cells . The bioactivity of PAF is tightly regulated by PAF acetylhydrolases (PAF-AH), which convert PAF back to lysoPAF . Contrary to earlier assumptions that lysoPAF is merely an inactive precursor, research shows that lysoPAF has opposing effects to PAF in neutrophil and platelet activation . While PAF potentiates neutrophil NADPH oxidase activation, lysoPAF inhibits this function dose-dependently . Similarly, in platelets, PAF promotes aggregation, while lysoPAF reduces platelet aggregation after low-dose thrombin stimulation . This antagonistic relationship suggests a balanced regulatory system where lysoPAF counteracts some of PAF's bioactivities.

How is PTAFR expression regulated during inflammatory conditions?

During inflammatory conditions, PTAFR expression can be upregulated through various cytokine-mediated pathways. In inflammatory diseases such as asthma, higher concentrations of PAF are found in sputum and bronchoalveolar lavage fluid from affected patients compared to healthy subjects . The regulation of PTAFR expression involves complex transcriptional control mechanisms responsive to inflammatory stimuli. In viral infections like COVID-19, studies have demonstrated significant hyperexpression of PTAFR in hospitalized patients, suggesting its involvement in the inflammatory and thrombotic complications of the disease . The expression levels of PTAFR are influenced by multiple factors including cytokine environments, cellular activation states, and disease progression. Research indicates that this receptor's expression pattern may serve as a valuable biomarker for disease severity and progression, particularly in conditions with significant inflammatory components.

What are the structural requirements for agonist-induced internalization of human PTAFR?

The internalization of human PTAFR following agonist binding involves specific structural elements, particularly in the C-terminal tail of the receptor. Research using mutational analysis has identified that the last 26 amino acids of the cytoplasmic tail contain determinants critical for endocytosis . A truncated mutant (Cys317→Stop) exhibits markedly reduced capacity to internalize PAF, confirming the importance of this region . Interestingly, mutations in the (D/N)P(X)2,3Y motif have differential effects: substitution of Asp289 to alanine abolishes both internalization and G-protein coupling, while substitution of Tyr293 to alanine abolishes coupling but not internalization . This suggests that internalization and G-protein coupling can be independent events for PTAFR. The receptor sequestration process appears to be mediated, at least partially, through clathrin-coated pits, as it is blocked by concanavalin A and other inhibitors of this endocytic pathway . Unlike some other G protein-coupled receptors, PTAFR internalization is not significantly affected by protein kinase C inhibition or activation, indicating a distinct regulatory mechanism.

How do PAF and lysoPAF differentially regulate signaling pathways through PTAFR?

The differential regulation of signaling pathways by PAF and lysoPAF through PTAFR represents a fascinating area of research with important implications for understanding inflammatory responses. While PAF activates phospholipase C through PTAFR, leading to calcium mobilization, lysoPAF does not induce calcium flux in neutrophils . Instead, lysoPAF stimulates adenylyl cyclase, resulting in increased intracellular cAMP levels in both neutrophils and platelets . This cAMP elevation is a key mechanism underlying lysoPAF's inhibitory effects. Pharmacological studies using SQ22536 (adenylyl cyclase inhibitor) demonstrate dose-dependent reversal of lysoPAF's inhibitory effect on superoxide generation, confirming the central role of the adenylyl cyclase-cAMP pathway . Additionally, inhibition of protein kinase A (PKA), a downstream effector of cAMP, partially reverses lysoPAF's inhibitory effect, suggesting both PKA-dependent and independent mechanisms . This signaling dichotomy between PAF and lysoPAF provides a model for understanding how structurally related ligands can exert opposing effects through interactions with the same receptor.

What methodologies are most effective for studying PTAFR-mediated cellular responses in different cell types?

To effectively study PTAFR-mediated cellular responses across different cell types, researchers should employ complementary methodologies targeting receptor expression, signaling, and functional outcomes. For receptor expression analysis, real-time quantitative PCR provides sensitive detection of PTAFR gene expression, as demonstrated in studies of COVID-19 patients . Flow cytometry using fluorescently-labeled antibodies offers quantitative assessment of surface receptor levels. When investigating signaling, calcium mobilization assays can detect PAF-induced responses, while cAMP assays are essential for studying lysoPAF effects . Functional assays should be tailored to the cell type: for neutrophils, superoxide production assays using cytochrome c reduction method effectively measure NADPH oxidase activation in response to PAF/lysoPAF ; for platelets, aggregation assays using light transmission aggregometry reveal the effects on clotting function . Cell-specific knockout models using CRISPR-Cas9 technology enable precise determination of PTAFR's role in different cellular contexts. For pharmacological manipulation, researchers should consider using both direct receptor antagonists and downstream signaling inhibitors (like adenylyl cyclase inhibitors) to distinguish receptor-dependent from receptor-independent effects.

What are the optimal expression systems for producing functional recombinant human PTAFR?

For producing functional recombinant human PTAFR, mammalian expression systems generally provide superior results compared to bacterial or insect cell systems. Chinese hamster ovary (CHO) cells have been successfully used in PTAFR research, demonstrating proper receptor folding, membrane localization, and signaling capabilities . HEK293 cells also represent an excellent alternative with high transfection efficiency and proper post-translational modifications. When designing expression constructs, researchers should include epitope tags (such as FLAG or HA) at the N-terminus rather than C-terminus to avoid interfering with C-terminal signaling determinants that are critical for internalization . Tetracycline-inducible expression systems offer advantages for controlling expression levels, which is particularly important given that GPCR overexpression can lead to constitutive activation or altered signaling properties. For purification of the receptor, inclusion of an N-terminal His tag enables metal affinity chromatography under mild detergent conditions. Stable cell lines are preferable for consistent experimental results, particularly when conducting compound screening or detailed structural studies. When comparing different expression systems, researchers should validate receptor functionality using ligand binding assays, calcium mobilization, and cAMP production to ensure the recombinant receptor accurately reflects native PTAFR properties.

How can researchers effectively differentiate between PAF-mediated and lysoPAF-mediated effects in experimental models?

Differentiating between PAF-mediated and lysoPAF-mediated effects requires careful experimental design and appropriate controls. Researchers should employ a systematic approach including:

  • Selective agonists and antagonists: Use highly purified PAF and lysoPAF preparations at physiologically relevant concentrations. Include PAF receptor antagonists (such as WEB 2086 or SR 27417) to confirm receptor specificity.

  • Biochemical readouts: Monitor opposing downstream signals - calcium mobilization for PAF and cAMP elevation for lysoPAF . A comparative time-course analysis can reveal the temporal relationship between these signaling events.

  • Functional assays: For neutrophils, measure superoxide production, which is enhanced by PAF but inhibited by lysoPAF . For platelets, compare aggregation responses, with PAF promoting and lysoPAF inhibiting aggregation after thrombin stimulation .

  • Enzyme manipulation: Use recombinant PAF-acetylhydrolase (rPAF-AH) to convert PAF to lysoPAF in situ, allowing observation of the transition from PAF-mediated to lysoPAF-mediated effects . Conversely, employ acetyl transferases to convert lysoPAF to PAF.

  • Genetic approaches: Utilize PTAFR variants with mutations that differentially affect responses to PAF versus lysoPAF to dissect receptor-specific mechanisms.

This multi-faceted approach enables researchers to clearly distinguish the often opposing effects of these structurally related lipid mediators.

What controls and validation steps are essential when studying PTAFR in inflammation models?

When studying PTAFR in inflammation models, several critical controls and validation steps are essential:

  • Genetic controls: Include PTAFR knockout models alongside wild-type controls to confirm receptor specificity. Conditional knockouts in specific cell populations can help determine cell-specific contributions.

  • Pharmacological validation: Use multiple structurally distinct PTAFR antagonists at appropriate concentrations to confirm receptor involvement. Include dose-response studies to establish potency relationships.

  • Expression verification: Quantify PTAFR expression levels using qPCR and Western blotting or flow cytometry before and during the inflammatory response. This is particularly important as receptor expression can change dramatically during inflammation.

  • Lipid mediator quantification: Measure both PAF and lysoPAF levels in relevant tissues or fluids using liquid chromatography-mass spectrometry to correlate receptor activation with ligand availability .

  • Pathway validation: Confirm activation of known downstream signaling components (e.g., calcium flux, cAMP levels) in parallel with functional outcomes .

  • Model-specific considerations: In asthma models, measure airway hyperreactivity, eosinophil infiltration, and mucus hypersecretion as functional outcomes of PTAFR signaling . For thrombosis models, assess platelet aggregation and clot formation.

  • Translational relevance: Compare findings in animal models with human samples where possible, such as PTAFR expression in patient samples from related inflammatory conditions .

These validation steps ensure that observations are specifically attributable to PTAFR signaling rather than off-target effects or model-specific artifacts.

How is PTAFR involved in thrombotic complications of inflammatory diseases?

PTAFR plays a crucial role in the thrombotic complications of inflammatory diseases through multiple mechanisms affecting platelet function and coagulation. During inflammation, increased production of PAF leads to enhanced platelet activation and aggregation via PTAFR signaling . Recent studies in COVID-19 patients have demonstrated significant hyperexpression of PTAFR in hospitalized patients, correlating with increased thrombotic risk . This receptor mediates PAF-induced activation of platelets, promoting their aggregation and release of pro-inflammatory and pro-coagulant factors . The PAF-PTAFR axis also enhances expression of adhesion molecules on platelets, increasing their interaction with endothelial cells and leukocytes to form inflammatory microvascular thrombi. In inflammatory conditions like severe asthma, elevated PAF levels contribute to microvascular thrombosis through PTAFR activation . Interestingly, the counterbalancing effect of lysoPAF, which increases cAMP in platelets and reduces their aggregation after thrombin stimulation, represents an endogenous regulatory mechanism that may be overwhelmed during severe inflammation . This understanding has therapeutic implications, as recombinant PAF-acetylhydrolase (rPAF-AH) treatment can reduce thrombotic complications by converting PAF to lysoPAF, potentially providing a dual benefit of reducing inflammation while preventing thrombosis .

How can PTAFR be targeted therapeutically in inflammatory diseases?

Therapeutic targeting of PTAFR in inflammatory diseases offers multiple strategic approaches based on receptor biology and signaling mechanisms:

  • Direct receptor antagonism: Selective PTAFR antagonists can block PAF binding, preventing downstream inflammatory signaling. Several generations of antagonists have been developed, with improved specificity and pharmacokinetic properties.

  • PAF-acetylhydrolase therapy: Recombinant human PAF-acetylhydrolase (rPAF-AH) represents a promising biological approach. By converting PAF to lysoPAF, it not only reduces pro-inflammatory PAF levels but also increases anti-inflammatory lysoPAF . In murine asthma models, rPAF-AH administration significantly reduced airway eosinophil infiltration, mucus hypersecretion, and airway hyperreactivity in response to methacholine challenge .

  • Targeting receptor internalization: Compounds that modulate PTAFR internalization could provide temporal control over receptor signaling. Research on the C-terminal determinants of internalization offers potential targets for such interventions .

  • Biased ligand development: Creating synthetic ligands that preferentially activate the lysoPAF-like cAMP pathway while minimizing calcium signaling could provide anti-inflammatory effects without pro-inflammatory consequences.

  • Combination approaches: Targeting PTAFR alongside other inflammatory mediators may provide synergistic benefits. For instance, combining PTAFR antagonism with leukotriene modifiers in asthma could address multiple inflammatory pathways simultaneously.

These therapeutic strategies require careful evaluation for efficacy and safety, particularly given the complex role of PTAFR in both physiological and pathological processes.

How should researchers address the apparent contradictions in PTAFR signaling data across different cell types?

Addressing contradictions in PTAFR signaling data across different cell types requires a systematic approach that acknowledges biological complexity while maintaining methodological rigor:

  • Cell-specific expression patterns: Characterize PTAFR expression levels and splice variants in each cell type using quantitative PCR and Western blotting. Different expression levels or receptor isoforms may explain divergent responses.

  • G-protein coupling profile analysis: Determine the predominant G-protein coupling preferences in each cell type using pertussis toxin (Gi inhibitor) and YM-254890 (Gq inhibitor). The ratio of Gq to Gi coupling significantly affects downstream signaling outcomes.

  • Signaling cascade components: Map the expression and activation of downstream effectors (adenylyl cyclase isoforms, phospholipase C variants, PKA, etc.) as these may differ between cell types .

  • Contextual factors: Systematically vary experimental conditions (cytokine environment, cell activation state, receptor density) to identify contextual determinants of signaling outcomes.

  • Temporal resolution: Perform high-resolution time-course experiments, as apparent contradictions may reflect different temporal phases of a complex response rather than truly contradictory mechanisms.

  • Single-cell analysis: Apply single-cell techniques to determine whether contradictions reflect heterogeneity within cell populations rather than true cell-type differences.

  • Computational modeling: Develop mathematical models incorporating cell-specific parameters to predict and explain divergent responses to PTAFR activation.

This comprehensive approach acknowledges that apparent contradictions often represent different facets of a complex biological system rather than experimental errors.

What statistical approaches are most appropriate for analyzing PTAFR expression data in clinical samples?

When analyzing PTAFR expression data in clinical samples, researchers should employ statistical approaches that account for the unique characteristics of receptor expression data and clinical variability:

  • Normalization strategies: For qPCR data, use multiple reference genes selected for stability in the specific tissue context rather than a single housekeeping gene. Apply the geNorm algorithm to determine the optimal combination of reference genes.

  • Distribution assessment: Test for normality using Shapiro-Wilk test, as PTAFR expression often follows non-normal distributions, particularly in heterogeneous clinical samples. Apply appropriate transformations (log, square root) when needed or select non-parametric alternatives.

  • Mixed effects models: When analyzing longitudinal data or repeated measures, use mixed effects models that account for both within-subject and between-subject variability. This is particularly important when tracking PTAFR expression changes during disease progression.

  • Multiple comparison correction: When comparing PTAFR expression across multiple patient subgroups or tissues, apply appropriate corrections for multiple comparisons (Benjamini-Hochberg for controlling false discovery rate or Bonferroni for family-wise error rate).

  • Correlation analyses: Use Spearman's rank correlation when assessing relationships between PTAFR expression and clinical parameters, as it makes fewer assumptions about data distribution than Pearson's correlation.

  • Multivariate approaches: Apply principal component analysis or partial least squares discriminant analysis to identify patterns in PTAFR expression in relation to multiple clinical variables simultaneously.

  • Power analysis: Conduct a priori power analysis to determine adequate sample sizes for detecting clinically meaningful differences in PTAFR expression, especially important given the high variability often observed in clinical samples.

These statistical approaches ensure robust and clinically relevant interpretation of PTAFR expression data in patient populations.

What emerging technologies could advance our understanding of PTAFR structure-function relationships?

Several cutting-edge technologies are poised to revolutionize our understanding of PTAFR structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM): This technique can now resolve GPCR structures at near-atomic resolution without the need for crystallization, potentially revealing PTAFR in various conformational states induced by different ligands (PAF vs. lysoPAF).

  • Single-molecule fluorescence resonance energy transfer (smFRET): This approach can track real-time conformational changes in PTAFR upon binding different ligands, providing insights into how structural rearrangements relate to differential signaling outcomes.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): By measuring hydrogen-deuterium exchange rates across the receptor, this technique can identify regions of PTAFR that undergo structural changes upon binding PAF versus lysoPAF.

  • Nanobody-based structural stabilization: Developing conformation-specific nanobodies can stabilize distinct PTAFR conformational states for structural studies, particularly those associated with different signaling outcomes.

  • Molecular dynamics simulations: Advanced computational approaches can model ligand-receptor interactions and conformational changes at microsecond to millisecond timescales, complementing experimental structural data.

  • GPCRome and interactome mapping: Proximity labeling techniques (BioID, APEX) combined with mass spectrometry can comprehensively map the PTAFR interactome in different cell types and activation states.

  • Artificial intelligence-based structure prediction: AlphaFold2 and similar AI approaches can predict PTAFR structures in complex with various ligands and interacting proteins, generating testable hypotheses about structure-function relationships.

These technologies, particularly when used in combination, promise to provide unprecedented insights into how PTAFR structure dictates its diverse signaling capabilities.

How might single-cell analysis technologies enhance our understanding of PTAFR expression heterogeneity in disease states?

Single-cell analysis technologies offer transformative approaches to understanding PTAFR expression heterogeneity in disease states:

  • Single-cell RNA sequencing (scRNA-seq): This technology can reveal the full spectrum of PTAFR expression across thousands of individual cells, identifying rare cell populations with unique expression patterns that might be obscured in bulk analysis. In inflammatory diseases, this approach could identify specific immune cell subsets with altered PTAFR expression.

  • Cellular indexing of transcriptomes and epitopes by sequencing (CITE-seq): By simultaneously profiling surface protein expression and transcriptomes, CITE-seq can correlate PTAFR protein levels with transcriptional states at single-cell resolution, addressing potential disconnects between mRNA and protein expression.

  • Single-cell ATAC-seq: This technique reveals chromatin accessibility patterns controlling PTAFR gene expression in individual cells, providing insights into the epigenetic regulation of receptor expression heterogeneity.

  • Spatial transcriptomics: Technologies like Visium or MERFISH can map PTAFR expression within tissue architecture, revealing spatial relationships between PTAFR-expressing cells and pathological features in diseased tissues.

  • Mass cytometry (CyTOF): Using metal-tagged antibodies, CyTOF can simultaneously measure PTAFR expression alongside dozens of other markers in individual cells, enabling deep phenotyping of PTAFR-expressing populations.

  • Single-cell secretome analysis: Microfluidic approaches capturing cell-specific secreted factors can correlate PTAFR expression with functional outputs at the single-cell level.

  • Trajectory inference algorithms: Computational methods applied to single-cell data can reconstruct the dynamics of PTAFR expression changes during disease progression, revealing potential intervention points.

These technologies promise to transform our understanding of PTAFR biology by revealing heterogeneity masked in population-level studies, potentially leading to more precise therapeutic targeting.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.