Recombinant Human Platelet glycoprotein Ib beta chain (GP1BB)

Shipped with Ice Packs
In Stock

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol.
Note: If you have specific requirements for the glycerol content, please specify them in your order remarks.
For lyophilized powder delivery forms, the buffer used before lyophilization is a Tris/PBS-based buffer with 6% Trehalose.

Form
Available in either liquid or lyophilized powder form.
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized powder has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Synonyms
GP1BB; Platelet glycoprotein Ib beta chain; GP-Ib beta; GPIb-beta; GPIbB; Antigen CD42b-beta; CD antigen CD42c
Datasheet & Coa
Please contact us to get it.
Expression Region
26-206aa
Mol. Weight
39.3 kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Gp-Ib, a surface membrane protein of platelets, plays a crucial role in platelet plug formation by binding to von Willebrand factor, which is already attached to the subendothelium.
Gene References Into Functions
  1. Rare variants in GP1BB are associated with autosomal dominant macrothrombocytopenia. PMID: 28064200
  2. Research indicates that the localization of the GP Ib-IX complex to the lipid domain is facilitated by the transmembrane domains of GP Ibbeta and GP IX. PMID: 26203189
  3. Low levels of CD9 coinciding with a novel nonsense mutation in glycoprotein Ibbeta were observed in a patient with Bernard-Soulier syndrome. PMID: 26275786
  4. In pediatric BSS patients with a mutation in the GPIbbeta gene, even without prominent symptoms, a suspicion of 22q11.2 deletion is warranted. PMID: 23566026
  5. GPIbbeta missense mutations linked to Bernard-Soulier syndrome were studied for their impact on GPIb-IX complex surface expression. Mutations A108P and P74R were found to maintain normal secretion/folding of GPIbbeta(E) but failed to support GPIX surface expression. PMID: 21908432
  6. A unique variant of Bernard Soulier syndrome is described, characterized by a Ser23 Stop codon mutation in GPIbbeta, causing premature termination of translation. PMID: 19484238
  7. A 14-month-old boy with Bernard-Soulier syndrome was found to be homozygous for a nonsense mutation (c.423C > A) in the glycoprotein Ib-beta. PMID: 22343686
  8. TRAF4 has been identified as a novel binding partner for GPIb-IX-V and GPVI in human platelets. PMID: 20946164
  9. The putative convex surface of the LRR domain in GPIX, in the context of the full-length subunit, is sufficient for mediating its association with GPIbbeta. PMID: 19566547
  10. Lateral clustering of platelet GP Ib-IX complexes leads to an increase in the adhesive function of integrin alpha IIbbeta 3. PMID: 11812775
  11. The role of GPIbbeta in modulating vWF-mediated platelet adhesion has been investigated. PMID: 11816713
  12. A missense mutation in GP1BB suppresses GPIb/IX complex expression and is linked to Bernard-Soulier Syndrome in the homozygous form and giant platelets in the heterozygous form. PMID: 11816714
  13. The cysteine knot of platelet GPIb beta is essential for the interaction between GPIb beta and GPIX. PMID: 12036872
  14. PKA-mediated phosphorylation of GPIbbeta at Ser(166) negatively regulates VWF binding to GPIb-IX, contributing to PKA-mediated platelet inhibition. PMID: 12361948
  15. The intracellular domain of GPIb beta plays a role in regulating the adhesive properties of the GPIb/V/IX complex through phosphorylation of GPIb beta Ser166, highlighting a potential cross-talk between the GPIb beta and GPIb alpha intracellular domains. PMID: 12522011
  16. A novel hemizygous variant of Bernard-Soulier Syndrome has been identified, involving a substitution of Pro29 with Leu in one GPIbbeta allele. PMID: 12529755
  17. To study the critical sequence in the beta3 cytoplasmic domain involved in integrin signaling, cell lines coexpressing the platelet receptor for GP1BB were established. PMID: 12860973
  18. A novel GPIbbeta mutation has been identified as the cause of the Bernard-Soulier syndrome phenotype. This mutation explains the reduced platelet content of GPIb-IX complex observed in the heterozygous individuals studied. PMID: 12958615
  19. The SEPT5 gene, located approximately 250 nucleotides 5' to the GP Ibbeta gene, has been associated with modulating exocytosis from neurons and platelets as part of a presynaptic protein complex. PMID: 15213102
  20. Patients with velocardiofacial syndrome exhibit in-vitro defects in platelet function, potentially increasing their risk of bleeding during surgery. PMID: 18064328
  21. The N1421K substitution in VWF affects the GPIb binding site or a recognition element through a conformational change in the A1 domain. PMID: 18637125
  22. Proplatelet formation in human megakaryocytes undergoes complex spatio-temporal regulation orchestrated by adhesive proteins, GPIb-IX-V, and myosin IIA. PMID: 18752571
  23. A novel Ser 23 Stop mutation in GPIbbeta is responsible for BSS in the studied family and hinders the complex from forming on the platelet surface. PMID: 18825380

Show More

Hide All

Database Links

HGNC: 4440

OMIM: 138720

KEGG: hsa:2812

STRING: 9606.ENSP00000383382

UniGene: Hs.283743

Involvement In Disease
Bernard-Soulier syndrome (BSS)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed in heart and brain.

Q&A

What is the structure of human platelet glycoprotein Ib beta chain?

The human platelet glycoprotein Ib beta chain (GP1BB) is a transmembrane protein that serves as a component of the platelet receptor for von Willebrand factor. The primary structure has been established through cDNA cloning and amino acid sequence analysis. GP1BB is synthesized as a 206 amino acid precursor protein from a 1.0-kb mRNA expression in megakaryocytes and megakaryocytic-like cell lines. The protein contains a signal peptide of 28 amino acids and a mature protein of 181 amino acids. The structure includes a notable leucine-rich sequence of 24 amino acids in the amino-terminal region, which shares similarity with sequences found in the alpha chain of GPIb and leucine-rich alpha 2-glycoprotein. This leucine-rich sequence is flanked on both sides by amino acid sequences that are similar to those flanking the leucine-rich tandem repeats in related proteins.

The protein contains three distinct domains: an extracellular amino-terminal region, a transmembrane segment of 25 amino acids, and an intracellular segment of 34 amino acids at the carboxyl terminus. The intracellular segment contains an unpaired cysteine and two potential sites for phosphorylation by cAMP-dependent protein kinase, suggesting regulatory functions.

How does GP1BB interact with other components of the GPIb-IX-V complex?

GP1BB functions as an integral component of the platelet membrane receptor complex known as GPIb-IX-V. This complex serves as the major binding site for von Willebrand factor on platelets. Within this complex, GP1BB associates with glycoprotein Ibα (GP1BA), which is the major ligand-binding subunit of the complex. The association between GP1BB and other subunits is essential for the proper expression and function of the receptor complex.

Research into Bernard-Soulier Syndrome (BSS), a rare autosomal recessive bleeding disorder characterized by large platelets and thrombocytopenia, has revealed that mutations in the genes encoding GP1BA, GP1BB, or GP9 can disrupt the formation and function of the GPIb-IX-V complex. Flow cytometry analysis of patients with BSS demonstrates significantly reduced expression of CD42a (GPIX) and CD42b (GPIb) on platelet surfaces compared to healthy controls, highlighting the interdependence of these proteins for stable complex formation.

What methods are most effective for recombinant expression of GP1BB?

For successful recombinant expression of GP1BB, the choice of expression system is critical. Based on research protocols, human erythroleukemia cells (HEL cells) have proven effective for obtaining GP1BB expression. These cells exhibit megakaryocytic-like properties and naturally express GP1BB. For recombinant production, lambda phage cDNA expression libraries prepared from HEL cells have been successfully screened using radiolabeled affinity-purified rabbit polyclonal antibodies to the beta chain of GPIb.

The CHRF-288-11 cell line also exhibits megakaryocytic-like properties and synthesizes two related GP1BB mRNA species of 3.5 and 1.0 kb, making it another potential candidate for expression studies. When constructing expression vectors, researchers should include the complete open reading frame of 618 nucleotides that encodes both the signal peptide (28 amino acids) and the mature protein (181 amino acids), followed by a stop codon.

Mammalian expression systems are generally preferred over bacterial systems due to the importance of proper post-translational modifications, particularly glycosylation, for the correct folding and function of GP1BB.

What techniques are recommended for purification and characterization of recombinant GP1BB?

Purification of recombinant GP1BB typically employs a combination of techniques, beginning with affinity chromatography using antibodies specific to GP1BB. Subsequent characterization should include both structural and functional analyses:

  • Structural verification:

    • Edman degradation of the intact beta chain and peptides produced by chemical cleavage can verify amino acid sequences.

    • Mass spectrometry can confirm protein mass and identify post-translational modifications.

    • Western blotting can assess protein integrity and expression levels.

  • Functional assessment:

    • Flow cytometry using fluorescently labeled antibodies against GP1BB (CD42c) can verify surface expression and proper folding.

    • Binding assays with von Willebrand factor can determine functional activity.

For comprehensive characterization of glycosylation patterns, which may affect protein function, mass spectrometry glycomics and glycopeptide analysis are recommended. These techniques can identify both N- and O-glycosylation sites and characterize the attached glycan structures.

How can researchers effectively analyze GP1BB glycosylation patterns?

Analysis of GP1BB glycosylation requires sophisticated methodological approaches. Based on successful studies of the related GP1BA ectodomain, researchers should consider the following comprehensive strategy:

  • Sample preparation: Subject purified GP1BB to digestion with various combinations of bacterial mucinases (such as StcE and SmE), glycosidases, and commercial proteases to generate glycopeptides.

  • Mass spectrometry analysis: Employ LC-MS/MS to identify both glycosylation sites (glycosites) and the structures of the attached glycans. This approach can reveal diverse repertoires of N- and O-glycans, including sialoglycans and other complex structures.

  • Comparative analysis: When possible, compare recombinant GP1BB with platelet-derived protein to identify any differences in glycosylation patterns that might affect functional studies.

  • Site-specific glycan characterization: For comprehensive understanding, researchers should aim to site-localize specific glycan structures identified from glycomics analysis using glycopeptide data.

This multi-step approach will provide detailed information about both the locations and structures of glycans on GP1BB, which may have significant implications for protein function and interaction with binding partners.

What genetic approaches are useful for studying GP1BB mutations?

For investigating GP1BB mutations, particularly in the context of Bernard-Soulier Syndrome, researchers should employ a systematic genetic analysis approach:

  • DNA isolation and amplification: Extract genomic DNA from appropriate samples (e.g., EDTA blood) using standardized kits. Amplify the coding regions of GP1BB using PCR with specific primers.

  • Sequencing and variant identification: Perform Sanger sequencing of purified DNA fragments to identify potential mutations. Reference sequences should be used for comparison (e.g., NM_000407.4 for the GP1BB gene).

  • Variant assessment: Evaluate identified variants using computational algorithms such as PolyPhen2, SIFT, Mutation Taster, and CADD to predict potential functional effects. Check variant frequencies in population databases such as gnomAD to assess rarity.

  • Familial studies: When possible, investigate carrier status in family members to establish inheritance patterns and confirm pathogenicity of identified variants.

  • Functional validation: Complement genetic findings with functional studies, such as flow cytometry analysis of platelet glycoprotein expression, to establish genotype-phenotype correlations.

This comprehensive approach enables researchers to identify novel mutations in GP1BB and understand their potential impact on protein function and disease pathogenesis.

How can researchers assess the role of GP1BB in platelet-von Willebrand factor interactions?

Investigating the functional role of GP1BB in platelet-von Willebrand factor (vWF) interactions requires specialized methodologies:

  • Flow cytometry analysis: Quantify GP1BB (CD42c) expression levels on platelets or transfected cell lines using specific antibodies. This approach can reveal expression deficiencies associated with mutations or experimental manipulations.

  • Binding assays: Develop assays using purified vWF and recombinant or native GP1BB to measure direct binding interactions. These can be performed under static conditions or using flow-based systems to mimic physiological shear stress.

  • Functional platelet studies: Compare platelet aggregation responses to ristocetin (which enhances vWF-GPIb binding) between samples with normal and altered GP1BB expression or structure.

  • Structure-function analysis: Engineer recombinant GP1BB variants with specific mutations or domain deletions to identify regions critical for complex formation and vWF binding.

What methods are most reliable for studying GP1BB phosphorylation?

The intracellular segment of GP1BB contains two potential sites for phosphorylation by cAMP-dependent protein kinase. To study these phosphorylation events effectively, researchers should consider:

  • Phospho-specific antibodies: Develop or acquire antibodies that specifically recognize phosphorylated forms of GP1BB at the relevant sites.

  • Mass spectrometry-based phosphoproteomics: Use enrichment techniques such as phosphopeptide enrichment followed by LC-MS/MS to identify and quantify phosphorylation sites with high sensitivity and specificity.

  • In vitro kinase assays: Reconstitute phosphorylation reactions using purified components (cAMP-dependent protein kinase and recombinant GP1BB intracellular domain) to establish direct enzyme-substrate relationships.

  • Phosphorylation site mutants: Create recombinant GP1BB variants with mutations at the predicted phosphorylation sites (e.g., serine/threonine to alanine substitutions) to assess the functional consequences of phosphorylation through comparative studies.

  • Signaling pathway analysis: Investigate how various platelet agonists or inhibitors affect GP1BB phosphorylation status to understand its regulation in different activation states.

These approaches will provide insights into how phosphorylation modulates GP1BB function and potentially regulates the activity of the entire GPIb-IX-V complex.

How does GP1BB contribute to the pathophysiology of Bernard-Soulier Syndrome?

Bernard-Soulier Syndrome (BSS) is a rare autosomal recessive bleeding disorder characterized by large platelets and thrombocytopenia. Mutations in GP1BA, GP1BB, or GP9 genes, which encode components of the platelet surface receptor glycoprotein complex GPIb-IX-V, can cause this disorder. The specific contribution of GP1BB mutations to BSS pathophysiology can be investigated through:

  • Genetic analysis: Comprehensive sequencing of the GP1BB gene in BSS patients can identify causative mutations. Both homozygous and compound heterozygous mutations have been documented.

  • Expression studies: Flow cytometric analysis of platelet surface glycoproteins in BSS patients reveals significantly reduced expression of CD42a (GPIX) and CD42b (GPIb) compared to heterozygous carriers and controls. This approach can help establish genotype-phenotype correlations.

  • Morphological assessment: Examination of blood films from BSS patients shows characteristically large platelets, though the degree of platelet enlargement may vary between patients.

  • Functional assays: Platelet function tests, including assessment of ristocetin-induced platelet aggregation, can demonstrate the functional consequences of GP1BB mutations.

  • Recombinant protein studies: Expression of wild-type and mutant GP1BB in heterologous systems can reveal defects in protein folding, complex assembly, or ligand binding.

These methodological approaches provide insights into how specific GP1BB mutations disrupt the formation or function of the GPIb-IX-V complex, leading to the bleeding tendency observed in BSS patients.

What are the recommended approaches for functional characterization of novel GP1BB variants?

When characterizing novel GP1BB variants identified in patient samples or through genetic screening, researchers should implement a multi-faceted approach:

  • In silico analysis: Use computational tools such as PolyPhen2, SIFT, Mutation Taster, and CADD to predict the potential impact of amino acid substitutions or other mutations on protein structure and function.

  • Population frequency assessment: Check databases like gnomAD to determine variant rarity, as pathogenic variants are typically absent or extremely rare in general populations.

  • Expression studies: Express the variant GP1BB in appropriate cell lines to assess:

    • Protein expression levels and stability

    • Ability to form complexes with other GPIb-IX-V components

    • Subcellular localization

  • Structural analysis: If possible, use techniques such as circular dichroism or X-ray crystallography to determine how the variant affects protein folding and structure.

  • Functional testing: Develop binding assays to assess the variant's impact on interactions with von Willebrand factor and other binding partners.

  • Patient platelet studies: When available, analyze patient platelets carrying the variant to assess expression levels, complex formation, and functional responses.

This comprehensive characterization enables researchers to classify variants as benign, likely pathogenic, or pathogenic, contributing to our understanding of structure-function relationships in GP1BB and improving clinical interpretation of genetic findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.