Recombinant Human Polycystic kidney disease 2-like 2 protein (PKD2L2)

Shipped with Ice Packs
In Stock

Description

Introduction to PKD2L2

Recombinant Human Polycystic Kidney Disease 2-Like 2 Protein (PKD2L2) is a genetically engineered form of the human PKD2L2 protein, a member of the polycystin family. This protein shares structural homology with Polycystin-2 (PKD2), a calcium-permeable cation channel implicated in autosomal dominant polycystic kidney disease (ADPKD) . PKD2L2 is encoded by the PKD2L2 gene (UniProt ID: Q9NZM6) and is expressed in tissues such as kidney, brain, and testis . Recombinant PKD2L2 is produced in E. coli with an N-terminal His tag, enabling purification and functional studies .

Primary Structure

The full-length PKD2L2 protein comprises 624 amino acids, including six transmembrane domains and cytoplasmic N- and C-termini . Key domains include:

  • Transmembrane helices (S1–S6): Critical for ion channel formation.

  • Extracellular domain: Implicated in channel assembly and ligand interactions .

  • EF-hand motifs: Potential calcium-binding regions (absent in some homologs like polycystin-L) .

Table 1: Amino Acid Sequence Highlights

RegionSequence (Residues)
N-terminalMAEASRWHRGGASKHKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKV...
Transmembrane S6...VKADYSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKDEDKKTKGSGDLAEQARREGFDENEIQNAEQMKKWKERLEKKYYSMEIQDDYQPVTQEEFRELFLYAVELEKELHYINLKLNQVVRKVSAL

Tertiary and Quaternary Structure

Cryo-EM studies of PKD2 (a homolog) reveal a homotetrameric architecture with a central ion permeation pathway . PKD2L2 likely adopts a similar structure, featuring:

  • Two constriction points: A selectivity filter (residues 641–643) and a cytoplasmic gate (residues Leu677–Asn681) .

  • Voltage-sensor domain: Retains two gating charges, suggesting regulatory mechanisms .

Ion Channel Activity

PKD2L2 is hypothesized to function as a nonselective cation channel with permeability to Na⁺, K⁺, and Ca²⁺ . Key functional characteristics include:

  • Calcium selectivity: Higher permeability to Ca²⁺ compared to monovalent ions .

  • Regulation by ions: Inhibited by Ca²⁺, La³⁺, and Gd³⁺ .

Pathophysiological Role

While direct mutations in PKD2L2 are not linked to ADPKD, its interaction with PKD1/PKD2 may modulate cystogenesis:

  • Compensatory upregulation: Deleting miR-17 motifs in PKD2 enhances PC2 expression and reduces cyst growth in PKD1-mutant models .

  • Cellular signaling: Derepression of PKD2L2 correlates with reduced Yap1 and c-Myc activity, pathways implicated in cyst proliferation .

Research Applications

Recombinant PKD2L2 is utilized in diverse experimental contexts:

Physicochemical Properties

  • Molecular weight: ~70 kDa (calculated) .

  • Buffer: Tris/PBS with 6% trehalose (pH 8.0) .

  • Reconstitution: Optimized in deionized water (0.1–1.0 mg/mL) with 50% glycerol for stability .

Therapeutic Implications

  • miR-17 targeting: Anti-miR-17 oligonucleotides (e.g., RGLS4326) upregulate PKD2L2 expression, mitigating cyst growth in murine ADPKD models .

  • Compensatory mechanisms: Enhanced PKD2L2 expression restores mitochondrial function and reduces CREB/YAP signaling in PKD1-mutant cells .

Comparative Analysis: PKD2 vs. PKD2L2

FeaturePKD2 (TRPP2)PKD2L2 (TRPP5)
Gene associationADPKD (15% of cases) No direct disease link
Tissue expressionKidney, placenta Kidney, brain, testis
Channel selectivityCa²⁺ > Na⁺/K⁺ Predicted Ca²⁺/Na⁺/K⁺
Regulatory motifsmiR-17 in 3′-UTR Conserved miR-17 motif

Future Directions

  • Mechanistic studies: Elucidate PKD2L2’s role in calcium signaling and cyst suppression.

  • Therapeutic targeting: Explore small molecules or gene therapies to modulate PKD2L2 expression in polycystic diseases.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, serving as a guideline for customers.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is established during production. If you have a designated tag type, please communicate your requirement, and we will prioritize developing the specified tag.
Synonyms
PKD2L2; Polycystic kidney disease 2-like 2 protein; Polycystin-2L2; Polycystin-L2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-624
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PKD2L2
Target Protein Sequence
MAEASRWHRGGASKHKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKV MSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIY YENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYST SNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNA NVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQE VKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYF LACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFA YAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFF VLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKDEDKKTK GSGDLAEQARREGFDENEIQNAEQMKKWKERLEKKYYSMEIQDDYQPVTQEEFRELFLYA VELEKELHYINLKLNQVVRKVSAL
Uniprot No.

Target Background

Function
PKD2L2, as a potential subunit of a cation channel, is believed to play a crucial role in fertilization.
Database Links

HGNC: 9012

OMIM: 604669

KEGG: hsa:27039

STRING: 9606.ENSP00000290431

UniGene: Hs.716884

Protein Families
Polycystin family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
According to PubMed:10602361, expressed only in testis. According to PubMed:10756092, expressed also in brain and kidney. Isoform 2 is found only in transformed lymphoblasts. Isoform 3 is found in all tissues tested.

Q&A

Basic Research Questions

  • What is PKD2L2 and how does it relate to polycystic kidney disease genes?

PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel) is a protein-coding gene that belongs to the polycystin family. It shows significant homology to both polycystin-1 and polycystin-2, which are encoded by PKD1 and PKD2 genes respectively. These genes, when mutated, cause autosomal dominant polycystic kidney disease (ADPKD) . PKD2L2 encodes a protein of 613 amino acids that is approximately 65% similar to polycystin-2 . While PKD2L2 itself has not been directly implicated in renal cystic diseases, its striking homology to PKD1 and PKD2 implies similar roles that may contribute to understanding the function of both polycystin-1 and polycystin-2 .

  • Where is PKD2L2 expressed in human tissues?

Expression analysis reveals that PKD2L2 is primarily found in testis . Unlike some other polycystin family members that show broader tissue expression patterns, PKD2L2 appears to have a more restricted expression profile. For comparison, PKDREJ, another polycystin family member, shows additional expression in retina, brain, liver, and spleen as detected by RT-PCR . This tissue-specific expression pattern suggests PKD2L2 may have specialized functions in reproductive biology rather than broad physiological roles across multiple tissues.

  • What is the genomic location and structural organization of PKD2L2?

Advanced Research Questions

  • What methodologies are recommended for expressing recombinant PKD2L2 protein for functional studies?

For successful expression of recombinant PKD2L2 protein, researchers should consider the following methodological approach:

  • Expression system selection: Baculovirus-insect cell expression systems have proven effective for PKD2L2 and related proteins . This approach is particularly valuable as membrane proteins like PKD2L2 often fold incorrectly or form inclusion bodies in bacterial systems.

  • Vector design: Incorporate appropriate fusion tags to facilitate purification and detection. For example, N-terminal polyhistidine-tagged GST fusion constructs have been successfully used .

  • Protein purification protocol:

    • Use sterile buffer conditions (50mM Tris, 500mM NaCl, 0.5mM PMSF, 10% glycerol, pH 8.0)

    • Maintain cold chain during purification (store at <-20°C)

    • Minimize freeze-thaw cycles to preserve protein activity

  • Activity verification: The specific activity can be determined using synthetic peptide substrates. For similar proteins, activity around 30 nmol/min/mg has been reported using synthetic CREBtide peptide (KRREILSRRPSYR) as substrate .

  • Quality control: Assess purity (>82% by SDS-PAGE) and verify molecular mass (expected ~120 kDa) .

  • How can researchers investigate the ion channel properties of PKD2L2?

Investigation of PKD2L2 ion channel properties requires specialized electrophysiological approaches:

  • Lipid bilayer reconstitution: This technique has been successfully used for polycystin-2 from human syncytiotrophoblast apical membranes and could be adapted for PKD2L2. The approach revealed that polycystin-2 functions as a nonselective cation channel with multiple subconductance states and high permselectivity to Ca²⁺ .

  • Patch-clamp experiments: Heterologous expression systems such as Sf9 insect cells have been used to confirm channel function of polycystin family members . For PKD2L2 specifically, researchers should note that it "exhibits a lower single conductance but no spontaneous channel activity" compared to other family members .

  • Pharmacological profiling: Channel modulators such as Ca²⁺, La³⁺, Gd³⁺, and amiloride, which inhibit polycystin-2, can be tested on PKD2L2 to compare pharmacological profiles .

  • Calcium imaging: Since polycystin channels are involved in calcium signaling, calcium flux assays using fluorescent indicators can provide functional insights.

Channel PropertyPKD2PKD2L2Method of Detection
Single channel conductanceHigherLowerPatch-clamp
Spontaneous activityPresentAbsentPatch-clamp
Ca²⁺ permeabilityHighLikely presentIon substitution experiments
Subconductance statesMultipleNot fully characterizedSingle channel recordings
  • What approaches can be used to study the role of PKD2L2 in polycystic kidney disease models?

While PKD2L2 has not been directly implicated in ADPKD, its homology to PKD2 makes it relevant for comparative studies. Researchers can employ these approaches:

  • Gene editing techniques: CRISPR/Cas9 methodology has been successfully used to modify 3'-UTR regions of PKD genes to study their regulation . Similar approaches could target PKD2L2 to examine its potential compensatory role.

  • Cellular models: Both 2D and 3D culture systems are valuable for PKD research, including:

    • Human and animal primary renal epithelial cells

    • Immortalized cell lines

    • Pluripotent stem cell-derived models

    • 3D spheroid and organoid cultures

  • Expression modulation studies: Recent research has shown that preventing cis-inhibition of PKD2 expression can mitigate cystic phenotypes in PKD1-mutant models . Similar approaches could examine whether PKD2L2 expression affects disease progression.

  • Co-expression analysis: Since PKD1 and PKD2 proteins interact and are co-expressed in multiple subcellular locations, investigating potential interactions between PKD2L2 and other polycystins could reveal compensatory or regulatory mechanisms .

  • mRNA translation regulation: Recent findings demonstrate that PKD1 and PKD2 mRNAs are repressed via their 3′-UTR miR-17 binding elements. Similar regulatory mechanisms could be investigated for PKD2L2 .

  • How does PKD2L2 structurally and functionally compare to other polycystin family members?

PKD2L2 shares significant structural and functional similarities with other polycystin family members, but with notable differences:

FeaturePKD2 (Polycystin-2)PKD2L2PKD2LPKDREJ
Amino acid length9686138052253
Similarity to PKD2-~65%~65%~35% to both PKD1/PKD2
Primary expressionKidney, widespreadTestisTestisTestis, retina, brain, liver, spleen
Chromosome location4q22.110q315q3122q13.3
Channel activityNonselective cation channelLower conductance, no spontaneous activityNot fully characterizedNot fully characterized
Disease associationADPKDNot associated with ADPKDNot linked to ADPKDNot linked to ADPKD

The structure-function relationship analyses reveal that while PKD2L2 shares significant homology with polycystin-2, its distinct expression pattern and lower channel conductance without spontaneous activity suggest specialized physiological roles that differ from those of PKD2 .

  • What are the current methodological approaches for investigating PKD2L2 interactions with other proteins?

To investigate PKD2L2 protein interactions, researchers should consider:

  • Co-immunoprecipitation studies: Using specific antibodies against PKD2L2, such as anti-PKD2L2 antibody (HPA043634) , to pull down protein complexes from tissue or cell lysates.

  • Proximity labeling approaches: BioID or APEX2-based methods can identify proteins in close proximity to PKD2L2 in living cells.

  • Yeast two-hybrid screening: Can be employed to identify potential interaction partners, though validation in mammalian systems is essential.

  • Fluorescence resonance energy transfer (FRET): To study dynamic interactions in living cells.

  • Cryo-EM structural studies: Recent advances in cryo-EM have enabled structural characterization of TRP channel family members, including polycystin-2-L1 . Similar approaches could be applied to PKD2L2 to understand its structure and potential interaction interfaces.

  • Functional co-expression studies: Given that polycystin-1 and polycystin-2 are known to interact at their carboxy termini , similar interaction studies between PKD2L2 and other polycystins could reveal important functional relationships.

  • How can researchers distinguish between functions of PKD2L2 and other polycystin proteins in experimental systems?

Distinguishing between polycystin family members in experimental systems requires multiple complementary approaches:

  • Gene-specific knockdown or knockout: Using siRNA, shRNA, or CRISPR-Cas9 to specifically target PKD2L2 while monitoring other family members' expression levels.

  • Isoform-specific antibodies: Employing validated antibodies with confirmed specificity for Western blotting, immunoprecipitation, and immunohistochemistry .

  • Electrophysiological fingerprinting: Since PKD2L2 exhibits "lower single conductance but no spontaneous channel activity" compared to other family members, patch-clamp recordings can help distinguish its contribution to cellular ion channel activity.

  • Tissue-specific expression analysis: Since PKD2L2 shows restricted expression primarily in testis , tissue-specific studies can help isolate its functions.

  • Domain-specific mutations: Introducing mutations in regions unique to PKD2L2 can help determine which functions are specific to this isoform versus shared with other polycystins.

  • Rescue experiments: In knockdown/knockout models, selective re-expression of PKD2L2 versus other family members can reveal which functions are specifically attributable to PKD2L2.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.