Recombinant Human Potassium channel subfamily K member 13 (KCNK13)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant KCNK13

Recombinant KCNK13 is produced by overexpression in human embryonic kidney (HEK293) cells. Key features include:

PropertyDetails
Molecular Weight45.4 kDa
TagsDDK (FLAG) and Myc epitopes for detection and purification
StorageShipped in RIPA buffer; stable at -20°C with avoidance of freeze-thaw
Gene ID56659 (Human), encoding 337 amino acids
UniProt IDQ9HB14

The channel contains two pore-forming domains (P1 and P2) and four transmembrane segments (M1-M4). Its intracellular region includes a caspase-8 cleavage site critical for apoptosis regulation .

Ion Channel Activity

  • Regulation: Activated by arachidonic acid and inhibited by halothane .

  • Physiological Impact:

    • Maintains resting membrane potential in microglia, influencing surveillance and cytokine release .

    • Modulates apoptosis via caspase-8-mediated cleavage, accelerating cell shrinkage .

Pathophysiological Involvement

  • Neurodegeneration: Elevated KCNK13 expression in Alzheimer’s (AD) and Parkinson’s (PD) correlates with neuroinflammation and NLRP3 inflammasome activation .

  • Alcohol Response: Mediates ethanol-induced excitation of ventral tegmental area (VTA) neurons in rats, linked to reward pathways .

Experimental Models

ModelFindings
HEK293 CellsUsed for recombinant protein production and electrophysiological studies .
Rat Brain SlicesKCNK13 knockdown reduced ethanol-induced VTA neuron excitation .
Mouse MicrogliaTHIK-1 deficiency delayed apoptosis and reduced interleukin-1β release .

Therapeutic Insights

  • Neuroinflammation: KCNK13 inhibition may suppress microglial activation in AD/PD .

  • Alcohol Use Disorder: Targeting KCNK13 could alter ethanol reward mechanisms .

Key Studies

  1. Neurodegeneration (2023):

    • KCNK13 upregulation in AD/PD patients correlates with DNA hypomethylation and NLRP3 activation .

    • Implication: THIK-1 blockers might mitigate early-stage neuroinflammation.

  2. Ethanol Response (2023):

    • KCNK13 siRNA reduced ethanol-induced VTA neuron firing by 75% in rats .

    • Mechanism: Ethanol inhibits THIK-1, depolarizing neurons to enhance dopamine release .

  3. Apoptosis (2021):

    • Truncated KCNK13 mutants lacking intracellular domains caused abnormal Xenopus development, highlighting its role in programmed cell death .

Product Specs

Buffer
For liquid delivery forms, the protein is stored in a Tris/PBS-based buffer containing 5%-50% glycerol. Lyophilized powder is prepared using a Tris/PBS-based buffer containing 6% Trehalose before lyophilization.
Form
Liquid or Lyophilized Powder
Note: We prioritize shipping the format currently in stock. If a specific format is required, please indicate this in your order notes; we will fulfill requests as availability allows.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard protocol utilizes a final glycerol concentration of 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
(Tandem pore domain halothane-inhibited potassium channel 1)(THIK-1)
Datasheet & Coa
Please contact us to get it.
Expression Region
1-408aa
Mol. Weight
51.4 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Neuroscience
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
KCNK13
Target Protein Sequence
MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function

Potassium channel exhibiting weak inward rectification in symmetrical K+ solutions.

Gene References Into Functions
  1. Dysregulation of the potassium channel THIK-1, a caspase-8 target, accelerates cell shrinkage. PMID: 27566292
  2. In cells and tissues co-expressing THIK1 and THIK2, heterodimeric channels may contribute to cell excitability. PMID: 25148687
  3. Expression is observed in cellular hypoxia. PMID: 16683720
  4. THIK-1 and THIK-2 are abundantly expressed in the proximal and distal nephrons of the mammalian kidney. PMID: 18209473
Database Links

HGNC: 6275

OMIM: 607367

KEGG: hsa:56659

STRING: 9606.ENSP00000282146

UniGene: Hs.510191

Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of human KCNK13 protein?

KCNK13 belongs to the family of tandem pore domain potassium (K2P) channels. The protein contains four transmembrane segments (M1-M4) and two typical pore-forming regions (P1 and P2) that include the K+ selectivity filter consensus sequence. A distinctive feature is the large extracellular loop between M1 and P1. The protein also carries a caspase recognition sequence in its cytoplasmic region, which is functionally significant for its role in apoptosis . The human KCNK13 protein consists of 408 amino acids and shares approximately 58% sequence homology with KCNK12 (THIK-2) .

What are the primary functional characteristics of KCNK13?

KCNK13 produces background potassium currents that are inhibited by halothane and are relatively insensitive to extracellular pH variations . Unlike its homolog KCNK12 (which is considered a 'silent' channel), KCNK13 can generate functional K+ currents by itself. The channel displays mild voltage dependence, with moderate outward rectification at low external K+ concentrations and weak inward rectification with nearly symmetrical K+ concentrations . KCNK13 is activated by arachidonic acid and can also be regulated through G-protein-coupled receptor pathways and by polyanionic lipids such as PIP2 and oleoyl-CoA .

What is the chromosomal location and genetic information for human KCNK13?

In humans, the KCNK13 gene is assigned to chromosomal region 14q24.1-14q24.3 . The gene encodes the 408-amino acid potassium channel subfamily K member 13 protein, which functions as a potassium channel containing two pore-forming P domains .

What is the tissue distribution pattern of KCNK13 in humans?

In humans, KCNK13 expression is almost exclusively restricted to microglia, where it functions as the main potassium channel . Within the kidney, KCNK13 is mainly expressed in the proximal tubule (PT), thick ascending limb (TAL), and cortical collecting duct (CCD) . This highly specific expression pattern makes KCNK13 a potentially valuable target for selectively modulating microglial function in neurological disorders.

How does the expression of KCNK13 change under pathological conditions?

Research has shown that KCNK13 gene expression is regulated in response to certain conditions. For example, expression of KCNK13 is altered in a time-dependent manner after alcohol withdrawal . Additionally, changes in KCNK13 expression have been implicated in neuroinflammatory processes, which has led to interest in targeting this channel for conditions such as ALS and Alzheimer's disease . The regulation of KCNK13 expression appears to be context-dependent and may vary based on the specific pathological condition.

What are the best expression systems for producing recombinant human KCNK13?

For recombinant KCNK13 protein production, mammalian expression systems are preferred over bacterial systems due to the importance of post-translational modifications in channel function. HEK-293 cells have been successfully used to express recombinant KCNK13 with appropriate tags (such as His-tag) for purification purposes . When designing expression constructs, care should be taken to include the full protein sequence (amino acids 1-408 for human KCNK13) to ensure proper folding and channel assembly.

What electrophysiological techniques are most appropriate for studying KCNK13 function?

Patch-clamp electrophysiology remains the gold standard for functional characterization of KCNK13 channels. Both whole-cell and single-channel recordings have been used to assess KCNK13 channel properties. For accurate measurement of background potassium currents, researchers should consider:

  • Voltage ramp protocols that can reveal the characteristic mild voltage dependence of KCNK13

  • Pharmacological isolation using specific channel blockers to separate KCNK13 currents from other potassium conductances

  • Testing modulators such as arachidonic acid, halothane, and polyanionic lipids to confirm channel identity

It's important to note that slice preparation methods can significantly reduce KCNK13 expression levels, potentially affecting electrophysiological measurements .

How can KCNK13 function be selectively manipulated in experimental models?

Several approaches have been developed to selectively manipulate KCNK13 function:

  • RNA interference: Small interfering RNAs (siRNAs) targeting KCNK13 have been successfully used to downregulate channel expression. Controls should include non-targeting siRNAs or siRNAs targeting related but distinct channels (e.g., KCNK12) .

  • Pharmacological modulation: Selective small-molecule inhibitors such as CVN293 are emerging as valuable tools for manipulating KCNK13 function .

  • Genetic approaches: Knockdown or knockout models can be created using CRISPR/Cas9 or conventional gene targeting methods.

When using these approaches, it's crucial to confirm the specificity of the manipulation through both molecular (qPCR, Western blot) and functional (electrophysiology) assessments.

What is the role of KCNK13 in microglial function and neuroinflammation?

KCNK13 functions as the main potassium channel in microglia and is responsible for maintaining their resting membrane potential through tonic background potassium conductance . Research has shown that KCNK13 activity can regulate multiple aspects of microglial function, including:

  • Microglial ramification (morphological changes)

  • Surveillance behavior of microglia

  • NLRP3 inflammasome activation

  • Release of pro-inflammatory cytokine interleukin-1β (IL-1β)

These findings position KCNK13 as an important modulator of neuroinflammation, making it a potential therapeutic target for conditions characterized by dysregulated microglial activity.

How does KCNK13 contribute to ethanol effects on neural circuits?

KCNK13 plays a significant role in ethanol's effects on neurons in the ventral tegmental area (VTA), a key region in reward processing. Ethanol inhibition of KCNK13 contributes to the excitation of VTA neurons, which is considered important for alcohol reward and reinforcement behaviors . Studies have demonstrated that:

  • Knockdown of KCNK13 using siRNA reduces ethanol excitation of VTA neurons

  • KCNK13 gene expression is altered in a time-dependent manner following alcohol withdrawal

  • Downregulation of KCNK13 alters alcohol drinking behavior

These findings suggest that KCNK13 represents a molecular target through which ethanol modulates neural activity in reward circuits.

What evidence supports KCNK13 as a therapeutic target for neurodegenerative diseases?

The selective expression of KCNK13 in microglia and its role in regulating neuroinflammatory processes has made it an attractive target for neurodegenerative conditions characterized by chronic neuroinflammation. Recent developments include:

  • The advancement of CVN293, a selective small-molecule inhibitor of KCNK13, into Phase 1 clinical trials

  • Target identification using the NETSseq platform, which highlighted KCNK13 as an important modulator of neuroinflammation

  • Ongoing investigation of KCNK13 inhibitors for conditions such as ALS and Alzheimer's disease

The selective targeting of KCNK13 represents a precision neuroscience approach to modulating neuroinflammation without broadly suppressing immune function.

What are the species-specific differences in KCNK13 function and how might they impact translational research?

Researchers should be aware of potential species differences when using animal models to study KCNK13. While both rat and mouse models have been used to investigate KCNK13 function, some differences have been noted:

  • There has been speculation regarding differences between rat and mouse KCNK13 in some studies of alcohol effects on VTA neurons

  • The mouse KCNK13 protein sequence differs slightly from the human sequence, which could impact pharmacological responses and protein-protein interactions

  • Expression patterns may vary between species

For translational research, it's advisable to compare findings across multiple species and to validate key observations in human cells or tissues when possible.

How do post-translational modifications regulate KCNK13 channel activity?

Post-translational modifications likely play important roles in regulating KCNK13 function, though this area remains incompletely characterized. Key considerations include:

  • The presence of a caspase recognition sequence in the cytoplasmic region, which enables regulation during apoptosis via caspase-8 cleavage

  • Potential phosphorylation sites that may mediate responses to G-protein-coupled receptor activation

  • Possible interactions with regulatory proteins that may modify channel gating or trafficking

Further research using mass spectrometry, site-directed mutagenesis, and protein interaction studies is needed to fully elucidate the post-translational regulation of KCNK13.

What are the technical challenges in developing high-throughput screening assays for KCNK13 modulators?

Developing effective screening assays for KCNK13 modulators presents several challenges:

  • As a background potassium channel, KCNK13 lacks the dramatic gating changes that make voltage-gated ion channels amenable to standard fluorescence-based assays

  • The mild voltage dependence and complex regulation by lipids and other factors necessitate specialized assay designs

  • Ensuring selectivity for KCNK13 over related K2P channels requires careful counter-screening

Researchers have addressed these challenges through approaches such as:

  • Membrane potential assays optimized for detecting subtle changes in background conductance

  • Electrophysiology-based screening using automated patch-clamp platforms

  • Binding assays using purified recombinant KCNK13 protein

How can structural biology approaches advance our understanding of KCNK13 function and pharmacology?

While detailed structural information specifically for KCNK13 is limited, advances in structural biology of related K2P channels provide valuable insights. Researchers interested in KCNK13 structure-function relationships should consider:

  • Homology modeling based on crystal structures of related K2P channels

  • Cryo-electron microscopy studies of purified recombinant KCNK13

  • Molecular dynamics simulations to understand channel gating and drug binding

These approaches can inform rational drug design efforts targeting KCNK13 and help elucidate the molecular mechanisms underlying channel regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.