Recombinant Human Potassium channel subfamily K member 16 (KCNK16)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
KCNK16; TALK1; Potassium channel subfamily K member 16; 2P domain potassium channel Talk-1; TWIK-related alkaline pH-activated K(+ channel 1; TALK-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNK16
Target Protein Sequence
MPSAGLCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLENYTC LDQWAMEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA GQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAAIERWEDRPRRSQVLQVLGLALFLTLGT LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI LLGLAWLALILPLGPLLLHRCCQLWLLSLRQGCGAKAAPGRRPRRGSTAARGVQVTPQDF PISKKGLGS
Uniprot No.

Target Background

Function

Recombinant Human Potassium channel subfamily K member 16 (KCNK16) is an outward rectifying potassium channel that generates rapidly activating and non-inactivating outward rectifier K+ currents.

Gene References Into Functions
  1. Research indicates that TALK-1 channels (KCNK16) are crucial regulators of beta-cell ER Ca2+. This suggests that TALK-1 may be a therapeutic target to mitigate ER Ca2+ handling defects in beta cells during diabetes pathogenesis. PMID: 28928238
  2. The TALK-1/iOPN complex induces Vm hyperpolarization and reduces beta-cell glucose-stimulated Ca2+ influx, which is predicted to inhibit glucose-stimulated insulin secretion. PMID: 28403169
  3. Findings reveal TALK-1 channels as significant modulators of second-phase insulin secretion. This suggests a clinically relevant mechanism for rs1535500, which might increase type 2 diabetes risk by limiting glucose-stimulated insulin secretion. PMID: 26239056
  4. Evidence suggests the presence of at least two functional TALK-1 variants that may act as background K+ currents in specific human pancreatic cells. PMID: 12724142
Database Links

HGNC: 14464

OMIM: 607369

KEGG: hsa:83795

STRING: 9606.ENSP00000391498

UniGene: Hs.287765

Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in pancreas. Not detectable in the other tissues tested.

Q&A

What is KCNK16 and what cellular functions does it regulate?

KCNK16 encodes the two-pore-domain potassium channel TALK-1 (Tandem of pore domains in a Weak Inward rectifying K+ channel). It represents the most abundant and β-cell-restricted K+ channel transcript in pancreatic islets . TALK-1 channels regulate membrane potential in β-cells, which critically influences calcium influx, calcium handling, and ultimately glucose-stimulated insulin secretion (GSIS). Dysfunction in these channels can lead to impaired insulin release and contribute to diabetic phenotypes through alterations in β-cell electrical activity .

How does KCNK16 differ from other potassium channels involved in glucose homeostasis?

While other potassium channels like KATP channels (encoded by KCNJ11 and ABCC8) are well-established regulators of β-cell function, KCNK16-encoded TALK-1 represents a distinct regulatory mechanism. TALK-1 belongs to the two-pore-domain K+ channel family, which exhibits different biophysical properties and regulatory mechanisms compared to KATP channels. Unlike KATP channels that close in response to increased ATP/ADP ratio during glucose metabolism, TALK-1 channels have more complex regulation that affects both plasma membrane potential and endoplasmic reticulum calcium handling . Additionally, KCNK16 shows highly selective expression in β-cells, suggesting a specialized role in insulin secretion regulation .

What physiological factors regulate TALK-1 channel activity?

While the search results don't comprehensively detail all physiological regulators, research suggests that TALK-1 activity involves complex regulatory mechanisms beyond simple metabolic coupling. The discrepancy between heterologously expressed and endogenously expressed TALK-1 channels points to "unidentified regulators of β-cell TALK-1 activity which could include endogenous ligands, protein interactions, and cellular localization of the channel" . Evidence from gene expression studies in KCNK16 L114P mutant islets indicates potential interactions with pathways involving cAMP signaling and SLIT-ROBO signaling, suggesting multiple layers of physiological regulation .

What mutations in KCNK16 have been linked to human disease?

The most significant KCNK16 mutation identified is the L114P mutation (c.341T>C, p.Leu114Pro), which segregates with MODY in affected families . This novel non-synonymous genetic mutation was discovered through exome sequencing in a four-generation family with autosomal dominant non-obese, non-ketotic antibody-negative diabetes that lacked mutations in previously known MODY genes . The L114P mutation occurs at a highly conserved base (GERP score 5.65), suggesting its functional importance in channel activity .

Through what molecular mechanisms does the L114P mutation alter TALK-1 channel function?

The L114P mutation causes a dramatic gain-of-function in TALK-1 channels. Electrophysiological studies in transfected HEK293 cells demonstrated a 312-fold increase in whole-cell K+ currents with TALK-1 L114P compared to wild-type channels . At physiologically relevant membrane potentials, the mutation produced a 7.96-fold increase in current at -30 mV and a 6.13-fold increase at 0 mV . This enhanced K+ conductance results from greater single channel activity, which hyperpolarizes the β-cell membrane potential, preventing the depolarization necessary for voltage-dependent calcium channel activation and subsequent insulin secretion .

How does altered KCNK16 function affect cellular pathways in pancreatic β-cells?

The gain-of-function in TALK-1 channels due to the L114P mutation disrupts multiple cellular pathways:

  • Electrical activity: Blunted β-cell membrane potential depolarization and loss of action potential firing in response to glucose

  • Calcium handling: Inhibited glucose-stimulated cytosolic Ca²⁺ influx (area under the curve at 20mM glucose: L114P 60.1 vs. WT 89.1; P=0.030) and reduced endoplasmic reticulum calcium storage (cyclopiazonic acid-induced release AUC: L114P 17.5 vs. WT 46.8; P=0.008)

  • Insulin secretion: Significantly reduced glucose-stimulated insulin secretion in both mouse (52% decrease, P=0.039) and human (38% decrease, P=0.019) islets expressing TALK-1 L114P

  • Gene expression: Altered expression of genes involved in insulin secretion regulation, including reduced expression of Fxyd3 (a negative regulator of GSIS) and increased expression of genes in cAMP-dependent and SLIT-ROBO signaling pathways

What animal models have been developed to study KCNK16 function?

Researchers have generated Kcnk16 L114P (L/P) mice using CRISPR-Cas9 genome editing technology . These mice were produced by the Vanderbilt Genome Editing Resource through pronuclear injection of ribonucleoprotein complexes comprising chemically modified ctRNA (crRNA+tracrRNA), enhanced specificity SpCas9 protein, and a 180-nucleotide single-stranded DNA donor containing the Kcnk16 L114P mutation into C57BL/6J embryos . The specific components used included:

  • crRNA sequence: 5'CCCTGCAGGTTATGGAAACC

  • 180-Nucleotide ssDNA sequence containing the mutation: 5'CTAGAGCTGGTGGTTGGGGGTGGGAGCCAGTTCTGGGCTCTCTTTTCCCCGCATCTGCACACTCCCTTGCCCTGCAGGTTATGGGAATCCAGCCCCCAGCACGGAGGCAGGGCAGGTCTTCTGTGTCTTCTATGCTCTGATGGGGATCCCACTCAATGTGGTCTTCCTCAACCATCTGGG

These transgenic mice exhibit a MODY-like phenotype with impaired glucose tolerance, reduced insulin secretion, and increased glucagon levels .

What are the optimal methods for assessing TALK-1 channel function in vitro?

Multiple complementary techniques have proven valuable for assessing TALK-1 channel function:

  • Electrophysiological approaches:

    • Whole-cell patch-clamp recordings to measure K⁺ currents in cells expressing TALK-1 channels

    • Perforated patch-clamp recordings to study membrane potential changes and action potential firing in intact islets and β-cell clusters

    • Single-channel recordings to analyze detailed biophysical properties

  • Calcium imaging:

    • Measurements of glucose-stimulated cytosolic Ca²⁺ influx

    • Assessment of endoplasmic reticulum calcium storage using agents like cyclopiazonic acid

  • Functional assays:

    • Glucose-stimulated insulin secretion measurements in isolated islets

    • Glucose inhibition of glucagon secretion assays

  • Expression analysis:

    • Targeted gene expression studies to identify compensatory mechanisms

    • Protein localization and trafficking analysis

What technical challenges must be addressed when working with recombinant KCNK16?

While the search results don't explicitly detail technical challenges specific to KCNK16, several challenges can be inferred from the discrepancies observed between heterologous expression and endogenous channel behavior:

  • Expression system selection: The dramatic difference in gain-of-function effects between heterologously expressed TALK-1 L114P (312-fold increase) versus endogenously expressed channels (modest increase) suggests that cellular context significantly influences channel behavior .

  • Regulatory factor identification: The search results note that "The K⁺ conductance differences between heterologously versus endogenously expressed TALK-1 L114P channels points toward unidentified regulators of β-cell TALK-1 activity" . This highlights the challenge of replicating physiological regulation in recombinant systems.

  • Physiological relevance: Ensuring that recordings of recombinant channels are conducted under conditions that mimic the physiological environment of β-cells, including appropriate membrane potential ranges, ion concentrations, and potential interacting proteins.

How can researchers distinguish between primary effects of KCNK16 mutations and compensatory mechanisms?

Distinguishing primary effects from compensatory responses requires multi-level analysis:

  • Acute vs. chronic expression: Compare acute expression of mutant channels (e.g., via viral transduction) with stable transgenic models to separate immediate consequences from adaptive responses.

  • Transcriptional profiling: Research in Kcnk16 L114P mice revealed multiple compensatory gene expression changes, including reduced expression of Fxyd3 (a negative regulator of GSIS) and increased expression of genes involved in cAMP signaling (Adcy5, Creb5, Adcyap1, Adcyap1r1) and SLIT-ROBO signaling (Slit1, Srgap3) . These changes suggest the development of Ca²⁺-independent mechanisms of insulin secretion to compensate for impaired Ca²⁺-dependent pathways.

  • Pathway analysis: The search results indicate that "SLIT-ROBO signaling regulates not only Ca²⁺ handling but also actin remodeling and thus, Ca²⁺-independent signaling pathways" . This suggests that comprehensive pathway analysis can help identify compensatory mechanisms.

  • Temporal studies: Examining phenotypes at different developmental stages or disease progression points can reveal the emergence of compensatory mechanisms over time.

What approaches can resolve discrepancies between in vitro and in vivo KCNK16 channel behavior?

The search results highlight a specific discrepancy: "while the slight increase in β-cell K⁺ conductance from Kcnk16 L114P mice would be predicted to partially alter islet excitability, these islets exhibit a complete loss of glucose-stimulated membrane potential depolarization" . Resolving such discrepancies requires:

  • Improved physiological context: Develop recording conditions that better preserve the native regulatory environment of TALK-1 channels.

  • Investigation of endogenous regulators: The search results suggest that "endogenous TALK-1 L114P polarizes plasma membrane potential," but the specific regulatory mechanisms remain unclear .

  • Combined methodologies: Integrate electrophysiological recordings with calcium imaging and functional assays to correlate channel activity with downstream effects.

  • Subcellular localization studies: Examine potential differences in channel distribution between heterologous expression systems and native β-cells.

How might KCNK16 research inform personalized medicine approaches for monogenic diabetes?

KCNK16-associated MODY represents a novel β-cell channelopathy distinct from previously characterized forms like those caused by KATP channel mutations (MODY12 and MODY13) . This has several implications for personalized medicine:

  • Diagnostic application: Including KCNK16 in genetic screening panels for unexplained monogenic diabetes cases could identify affected individuals who might benefit from targeted treatments.

  • Therapeutic development: Understanding the specific mechanism of TALK-1 L114P-induced diabetes (gain-of-function leading to membrane hyperpolarization) could guide development of selective TALK-1 inhibitors as potential precision therapeutics.

  • Treatment selection: Different MODY subtypes respond differently to available treatments (e.g., sulfonylureas for KATP channel mutations). Characterizing the clinical response of KCNK16-associated MODY to different therapeutic agents could inform optimal treatment selection.

  • Predictive modeling: Data from Kcnk16 L114P mice showing both reduced insulin secretion and elevated glucagon levels suggests that combined therapeutic approaches targeting both hormones might be necessary .

What specific protocols yield optimal expression of functional recombinant KCNK16?

While the search results don't provide detailed protocols for recombinant KCNK16 expression, several approaches can be inferred from the described research:

  • Expression systems: HEK293 cells have been successfully used for heterologous expression of both wild-type and mutant TALK-1 channels for electrophysiological studies .

  • Viral vectors: For studies in primary islets, adenoviral or lentiviral vectors can be used to express TALK-1 variants, as suggested by experiments comparing TALK-1 L114P and wild-type expression in mouse and human islets .

  • Transgenic approaches: For in vivo studies, CRISPR-Cas9 genome editing has been successfully employed to generate knock-in mice carrying the L114P mutation .

  • Functional validation: Expression should be verified not only by protein detection methods but also by functional assays such as patch-clamp recordings to confirm channel activity.

What analytical approaches best quantify changes in TALK-1 channel activity?

The search results demonstrate several effective analytical approaches:

  • Current-voltage relationships: Comparing whole-cell K⁺ currents across a range of membrane potentials between wild-type and mutant channels. The L114P mutation showed a 7.96-fold increase at -30 mV and a 6.13-fold increase at 0 mV compared to wild-type TALK-1 .

  • Single-channel analysis: Examining changes in single channel conductance, open probability, and gating kinetics to understand mechanistic details of channel dysfunction .

  • Membrane potential recordings: Assessing the impact of channel activity on β-cell membrane potential and action potential generation using perforated patch-clamp techniques .

  • Calcium dynamics: Quantifying the area under the curve for glucose-stimulated cytosolic Ca²⁺ responses and ER Ca²⁺ release to evaluate downstream consequences of altered channel function .

  • Secretion assays: Measuring glucose-stimulated insulin secretion and glucose inhibition of glucagon secretion to assess functional outcomes .

How can researchers effectively isolate KCNK16 effects from other K⁺ channels in complex cellular systems?

Isolating KCNK16-specific effects requires strategic approaches:

  • Genetic models: Utilizing Kcnk16 knockout or knock-in models provides the most definitive approach to isolate TALK-1 channel contributions .

  • Pharmacological tools: Although not mentioned in the search results, developing selective TALK-1 channel modulators would greatly facilitate research.

  • Biophysical properties: Exploiting the distinct biophysical characteristics of two-pore domain K⁺ channels compared to other K⁺ channel families.

  • Combined approaches: Correlating electrophysiological recordings with gene expression analysis and functional assays to build a comprehensive picture of TALK-1-specific effects.

What potential therapeutic targets might emerge from deeper understanding of KCNK16 biology?

Based on current understanding of TALK-1 channel function, several therapeutic approaches warrant investigation:

  • TALK-1 channel inhibitors: Selective inhibitors could counteract the gain-of-function effects seen in the L114P mutation and potentially improve insulin secretion.

  • Targeting compensatory pathways: The upregulation of cAMP-dependent and SLIT-ROBO signaling pathways in Kcnk16 L114P mice suggests these might represent alternative therapeutic targets .

  • Combined approaches: Given the dual defects in insulin secretion and glucagon suppression observed in Kcnk16 L114P mice, combination therapies targeting both hormones might prove beneficial .

  • Gene therapy: For monogenic forms of diabetes caused by KCNK16 mutations, gene therapy approaches to normalize channel function could eventually become feasible.

What unexplored physiological roles might KCNK16 play beyond established functions?

While KCNK16 is described as "β-cell-restricted" , further investigation might reveal additional roles:

  • Other islet cell types: The increased glucagon secretion observed in Kcnk16 L114P mice might reflect direct or indirect effects on α-cells .

  • Developmental roles: The search results show changes in islet composition in Kcnk16 L114P mice, including "an increase in glucagon-positive area/islet and a concurrent modest reduction in insulin-positive area/islet" , suggesting potential developmental influences.

  • Stress responses: Investigation of TALK-1 channel regulation under various metabolic stressors might reveal conditional roles in β-cell adaptation and survival.

  • Interactions with other channelopathies: Exploring potential synergistic or antagonistic effects between KCNK16 mutations and variants in other ion channels like KATP channels.

How might integrating KCNK16 research with broader -omics approaches advance understanding of β-cell dysfunction?

Integrating KCNK16 research with multi-omics approaches could yield several benefits:

  • Transcriptomics: The gene expression changes observed in Kcnk16 L114P islets (including altered expression of Fxyd3, Adcy5, Creb5, Adcyap1, Adcyap1r1, Slit1, and Srgap3) highlight how transcriptomic analysis can reveal compensatory mechanisms and pathway interactions .

  • Proteomics: Investigating the TALK-1 interactome could identify regulatory proteins that explain the discrepancy between heterologously expressed and endogenous channel behavior.

  • Metabolomics: Exploring how altered TALK-1 function affects metabolic pathways in β-cells could reveal secondary consequences beyond immediate effects on electrical activity.

  • Systems biology: Integrating data across multiple levels to model how TALK-1 dysfunction propagates through cellular networks to affect β-cell function and survival.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.