Recombinant Human Potassium channel subfamily K member 18 (KCNK18)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Recombinant KCNK18 exhibits dual rectification properties:

  • Outward rectification at depolarized potentials, stabilizing resting membrane potential .

  • Inward currents activated by Ca²⁺-mobilizing receptors (e.g., histamine) .

Regulatory Mechanisms:

  • Phosphorylation at serine residues (e.g., Ser252) by kinases reduces activity, while calcineurin-mediated dephosphorylation enhances it .

  • Heterodimerizes with TREK-1 (KCNK2) or TREK-2 (KCNK10) to modulate pain signaling in trigeminal ganglia .

Dysfunction Implications:

  • Loss-of-function mutations (e.g., F139WfsX24, C110R) cause hyperexcitability in sensory neurons, linked to familial migraine with aura .

  • Biallelic variants (p.Tyr163Asp, p.Ser252Leu) impair calcium-sensitive activation, associated with intellectual disability and autism spectrum disorder .

Research Applications

Recombinant KCNK18 enables mechanistic studies of channelopathies and drug discovery:

Key Findings from Functional Studies

Study FocusMethodOutcomeSource
Migraine-associated mutationsElectrophysiology (Xenopus oocytes)Frameshift mutant F139WfsX24 abolishes TRESK function via dominant-negative effects
Neurodevelopmental variantsCalcium imagingp.Ser252Leu disrupts 14-3-3 binding, reducing ionomycin-induced currents
Pharmacological modulationWhole-cell patch clampHydroxy-α-sanshool (Schezuan pepper metabolite) activates TRESK to alleviate pain

Therapeutic Potential

KCNK18 is a promising target for migraine treatment due to:

  • High specificity in trigeminal ganglia neurons .

  • Modulation by inflammatory mediators, making it responsive to calcineurin inhibitors .

  • Preclinical studies show TRESK activators could reduce neuronal hyperexcitability in migraine models .

Challenges and Future Directions

  • Genetic complexity: Single non-functional variants (e.g., C110R) show incomplete penetrance in migraine cohorts, suggesting polygenic influences .

  • Structural dynamics: Lack of full-length crystal structures limits drug design .

  • Translational studies: Further validation in animal models is needed to assess long-term efficacy and safety of TRESK-targeted therapies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your requests based on availability.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, it is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCNK18; TRESK; TRIK; Potassium channel subfamily K member 18; TWIK-related individual potassium channel; TWIK-related spinal cord potassium channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNK18
Target Protein Sequence
MEVSGHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVVFSAIEDGQVLVAADDGEFEK FLEELCRILNCSETVVEDRKQDLQGHLQKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYG YIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNRFRKFPFFTRPLLSKW CPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTL QLPPQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAI LPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEIVFIAFKLVQN RLIDIYKNVMLFFAKGKFYHLVKK
Uniprot No.

Target Background

Function
TRESK is an outward rectifying potassium channel. It generates rapidly activating outward rectifier K(+) currents. This channel may function as a background potassium channel that sets the resting membrane potential. Channel activity is directly activated by calcium signaling. It is activated via the G(q)-protein coupled receptor pathway. The calcium signal robustly activates the channel via calcineurin, while the anchoring of 14-3-3/YWHAH interferes with the return of the current to its resting state after activation. TRESK is also inhibited by arachidonic acid and other naturally occurring unsaturated free fatty acids. Channel activity is further enhanced by volatile anesthetics, such as isoflurane. TRESK appears to be the primary target of hydroxy-alpha-sanshool, an ingredient of Sichuan pepper. It may be involved in somatosensory function, particularly in pain sensation.
Gene References Into Functions
  1. The presence of SCN1A mutations and the absence of mutations in ATP1A2 or CACNA1A suggest that the Polish patients represent FHM type 3. PMID: 26747084
  2. This study reveals new pharmacological modulators of K2P18.1 activity, proving useful in dissecting the native function of K2P18.1. PMID: 24972239
  3. Our study demonstrates the presence of several KCNK18 gene mutations in both migraine with aura and migraine without aura. PMID: 25324165
  4. A migraine-associated TRESK mutation, but not the C110R variant, reduces the endogenous TRESK currents to a degree that affects trigeminal ganglion neuron excitability. PMID: 24805079
  5. The LQLP site is a fundamental determinant of the calcium-sensitivity of human TRESK. PMID: 25202008
  6. No association was observed for three polymorphisms in the KCNK18 gene with migraine phenotype or any haplotypes. PMID: 23911303
  7. T cell lymphoblastic leukemias/lymphomas express TRESK protein. PMID: 23541583
  8. A dominant-negative mutation of human TRESK was found to be linked to migraine with aura in a large pedigree. It is hoped that future TRESK agonists may prevent or ameliorate the debilitating symptoms of migraine. PMID: 22115960
  9. A frameshift mutation in the two-pore potassium channel protein TRESK is linked to migraine pathogenesis. (Review) PMID: 21855646
  10. TRESK plays a role in the pathogenesis of typical migraine with aura. PMID: 20871611
  11. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  12. A single residue of TRESK was found to be glycosylated upon heterologous expression. Signals of the N-glycosylation mutants were reduced by >50% due to inadequate surface expression of the channel. PMID: 20006580
  13. TRESK is a novel two-pore domain K+ channel that may set the resting membrane potential of cells in the spinal cord. PMID: 12754259
  14. TRESK is activated by increased cytoplasmic calcium concentration, with calcineurin being involved in the regulation; Serine 276 was identified as the major functional target of calcineurin in TRESK. PMID: 14981085
  15. TRESK-2 is a functional member of the K(2P) channel family and contributes to the background K+ conductance in many types of cells [TRESK-2]. PMID: 15123670
  16. Because 14-3-3 proteins are ubiquitous, they are expected to control the duration of calcineurin-mediated TRESK activation in all the cell types that express the channel, depending on the phosphorylation state of serine 264. PMID: 18397886
  17. Background K+ currents expressed in Jurkat cells are mediated by TRESK channels. PMID: 18506476
  18. Observational study of gene-disease association. (HuGE Navigator) PMID: 16385451

Show More

Hide All

Database Links

HGNC: 19439

OMIM: 613655

KEGG: hsa:338567

STRING: 9606.ENSP00000334650

UniGene: Hs.449650

Involvement In Disease
Migraine with or without aura 13 (MGR13)
Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed specifically in dorsal root ganglion and trigeminal ganglion neurons. Detected at low levels in spinal cord.

Q&A

What is KCNK18 and what is its primary function?

KCNK18 is a gene encoding the TWIK-related spinal cord K+ channel (TRESK), a member of the two-pore domain (K2P) family of potassium channels. Its primary function is maintaining neuronal excitability by contributing to the resting membrane potential of neurons. TRESK is calcium-dependent and regulated by the phosphatase calcineurin. The channel is prominently expressed in the dorsal root ganglia (DRG), trigeminal ganglia (TG), and various brain regions including the hypothalamus, frontal cortex, hippocampus, spinal cord, and substantia nigra . This expression pattern suggests its involvement in both pain pathways and various neurological functions.

How does TRESK channel regulation occur at the molecular level?

TRESK channel regulation primarily occurs through calcium-dependent dephosphorylation by calcineurin. Specifically, Ser252 has been identified as an important regulatory site of TRESK . Calcium influx activates calcineurin, which subsequently dephosphorylates TRESK, leading to channel activation and increased potassium conductance. This mechanism helps maintain the resting membrane potential and modulate neuronal excitability. Mutations affecting this regulatory pathway, such as the S252L variant, can disrupt normal channel function even without directly affecting the channel pore structure .

What expression systems are optimal for studying KCNK18 channel function?

Xenopus laevis oocytes represent the most widely used and reliable expression system for studying KCNK18/TRESK channel function. This system allows for robust expression of both wild-type and mutant channels, and enables precise electrophysiological characterization using two-electrode voltage-clamp techniques . For co-expression studies mimicking heterozygous or compound heterozygous conditions, equal amounts of different mRNAs can be injected into oocytes . Mammalian cell lines (HEK293, CHO) can also be used for more complex regulatory studies or when investigating interactions with mammalian-specific proteins.

What electrophysiological protocols are most effective for characterizing TRESK channel properties?

The standard protocol for TRESK characterization involves recording whole-cell basal currents at different voltages to generate current-voltage (I-V) relationships. Typically, voltage steps from -120 mV to +60 mV are applied from a holding potential of -80 mV . Potassium selectivity can be assessed by measuring reversal potentials in different extracellular K+ concentrations. For regulatory studies, calcineurin-dependent activation can be examined by applying the calcium ionophore ionomycin (0.5 μM) to increase intracellular calcium concentration, followed by monitoring the current amplitude changes over time .

How do patterns of inheritance differ among KCNK18-associated disorders?

KCNK18-associated disorders follow distinct inheritance patterns depending on the phenotype:

  • Autosomal Dominant Inheritance (Monoallelic Variants):

    • Migraine with or without aura (MIM#613656)

    • Heterozygous variants (particularly loss-of-function mutations) such as F139Wfsx24

  • Autosomal Recessive Inheritance (Biallelic Variants):

    • Intellectual disability, developmental delay, autism spectrum disorder, and seizures

    • Requires two affected alleles (homozygous or compound heterozygous variants)

This inheritance pattern differentiation reflects the varying pathophysiological mechanisms: migraine susceptibility may require only partial loss of channel function, while neurodevelopmental disorders appear to require more complete functional impairment .

How can researchers distinguish between pathogenic and benign KCNK18 variants?

Distinguishing pathogenic from benign KCNK18 variants requires a multi-faceted approach:

  • Functional assays:

    • Measure channel activity in heterologous expression systems

    • Quantify whole-cell currents, comparing mutant channels to wild-type

    • Assess dominant-negative effects in co-expression studies

  • Structural analysis:

    • Analyze position of variants relative to functional domains (selectivity filter, regulatory sites)

    • Prioritize variants in highly conserved residues across species

  • Segregation and population studies:

    • Analyze co-segregation with phenotype in families

    • Compare variant frequency in patient vs. control populations

    • Assess copy number variations to rule out alternative mechanisms

For example, the C110R variant causes complete loss of TRESK function but appears in both migraine and control cohorts, suggesting that a single non-functional allele is insufficient to cause migraine, highlighting the complex nature of KCNK18-related pathogenicity assessment .

What molecular mechanisms underlie the loss of function in different KCNK18 variants?

Different KCNK18 variants disrupt channel function through distinct mechanisms:

  • Truncating mutations (e.g., F139Wfsx24, p.Arg167Ter):

    • Produce incomplete proteins lacking critical functional domains

    • May cause nonsense-mediated decay of mRNA

    • Can exert dominant-negative effects on wild-type subunits in heterozygotes

  • Selectivity filter mutations (e.g., C110R):

    • Disrupt potassium selectivity and ion conduction

    • Affect a region crucial for channel function

    • Located adjacent to the selectivity filter, likely disruptive to pore structure

  • Regulatory site mutations (e.g., S252L):

    • Alter phosphorylation-dependent regulation

    • Affect calcineurin-mediated activation

    • May cause additive downstream effects

  • Missense mutations near functional domains (e.g., W101R):

    • Retain K+ selectivity but show dramatically reduced function

    • May affect channel gating or trafficking

    • Can still respond to calcineurin regulation despite reduced baseline activity

Understanding these mechanisms provides insight into structure-function relationships and may guide development of targeted therapeutic approaches .

What are the best approaches for modeling KCNK18 variants in neurons?

Modeling KCNK18 variants in neurons requires multiple complementary approaches:

  • Primary neuronal cultures:

    • Transfect wild-type or mutant KCNK18 into trigeminal ganglion or dorsal root ganglion neurons

    • Use lentiviral vectors for efficient delivery to primary neurons

    • Measure excitability changes using patch-clamp electrophysiology

    • Assess resting membrane potential, rheobase, and action potential threshold

  • CRISPR/Cas9 gene editing:

    • Generate precise mutations in endogenous KCNK18 gene in neuronal cell lines

    • Create isogenic lines differing only in the KCNK18 variant

    • Employ inducible systems to control timing of mutation expression

  • iPSC-derived neurons:

    • Generate induced pluripotent stem cells from patient samples

    • Differentiate into relevant neuronal subtypes

    • Compare electrophysiological properties with control lines

    • Rescue phenotypes by expressing wild-type KCNK18

  • In vivo models:

    • Develop knock-in mouse models carrying specific KCNK18 variants

    • Assess behavioral, electrophysiological, and molecular phenotypes

    • Use conditional expression systems to study developmental vs. acute effects

These approaches allow comprehensive assessment of how KCNK18 variants affect neuronal function in relevant cellular contexts .

How can copy number variations in KCNK18 be accurately detected and interpreted?

Copy number variations (CNVs) in KCNK18 require precise detection and careful interpretation:

Detection methods:

  • Quantitative PCR (qPCR) with TaqMan assays targeting specific exons

  • Multiplex ligation-dependent probe amplification (MLPA)

  • Digital droplet PCR for absolute quantification

  • Next-generation sequencing with depth-of-coverage analysis

  • Comparative genomic hybridization (CGH) arrays for larger CNVs

Interpretation considerations:

  • Validate findings using orthogonal methods

  • Compare with known CNV regions (a CNV overlapping the second exon and first and second introns of KCNK18 has been identified in Micronesian populations)

  • Use appropriate control regions devoid of CNVs (e.g., RNaseP)

  • Run samples in triplicate to ensure statistical validity

  • Use specialized software (e.g., CopyCaller) for accurate CNV calling

Proper CNV analysis is critical when evaluating individuals with suspected KCNK18-related disorders but no identifiable point mutations or small indels, as shown in studies where CNV analysis ruled out copy number changes as an alternative mechanism in individuals carrying the C110R variant .

How does TRESK channel function integrate with other ion channels in neuronal excitability?

TRESK channels function within a complex network of ion channels regulating neuronal excitability:

  • Interaction with voltage-gated channels:

    • TRESK maintains resting membrane potential, influencing activation threshold of voltage-gated Na+ channels

    • Loss of TRESK function may lower threshold for activation of Nav1.1 (SCN1A) and Cav2.1 (CACNA1A) channels

    • This functional interaction connects KCNK18-related pathology with other channelopathies involving SCN1A and CACNA1A

  • Balance with other K2P channels:

    • Multiple K2P channels (TREK, TASK, TRAAK) co-express with TRESK in sensory neurons

    • Compensatory upregulation of other K2P channels may occur in TRESK deficiency

    • Functional redundancy may explain incomplete penetrance of some KCNK18 variants

  • Contribution to neuronal hyperexcitability:

    • TRESK dysfunction leads to increased neuronal excitability

    • May enhance susceptibility to cortical spreading depression (CSD) in migraine

    • Contributes to network hyperexcitability in epilepsy and neurodevelopmental disorders

This integrated understanding helps explain how KCNK18 variants can contribute to diverse neurological phenotypes including migraine, epilepsy, and neurodevelopmental disorders .

What is the relationship between KCNK18 variants and cortical excitability in migraine pathophysiology?

The relationship between KCNK18 variants and cortical excitability in migraine involves several interconnected mechanisms:

  • Enhanced neuronal excitability:

    • TRESK dysfunction lowers threshold for neuronal activation

    • Increases probability of spontaneous firing in trigeminal neurons

    • Creates hyperexcitable state in cortical networks

  • Cortical spreading depression (CSD) susceptibility:

    • Loss of TRESK function may lower threshold for CSD initiation

    • CSD is believed to be the neurophysiological correlate of migraine aura

    • May trigger release of inflammatory mediators activating trigeminal nociceptors

  • Trigeminal system sensitization:

    • TRESK is highly expressed in trigeminal ganglia

    • Channel dysfunction leads to hyperexcitability of trigeminal neurons

    • Contributes to enhanced pain perception during migraine attacks

  • Interaction with migraine triggers:

    • TRESK dysfunction may increase sensitivity to common migraine triggers

    • Environmental and hormonal factors may further modulate channel function

    • Explains variability in attack frequency and severity among carriers

This multi-level relationship helps explain why KCNK18 variants can influence migraine susceptibility, though the incomplete penetrance of some variants (e.g., C110R) suggests additional genetic and environmental factors contribute to the clinical phenotype .

How can high-throughput functional assays be developed to assess KCNK18 variant pathogenicity?

Development of high-throughput functional assays for KCNK18 variant pathogenicity requires innovative approaches:

  • Automated patch-clamp platforms:

    • Adapt traditional electrophysiology to higher-throughput formats

    • Implement parallel recording from multiple cells expressing different variants

    • Standardize voltage protocols and analysis pipelines for consistent interpretation

  • Fluorescence-based assays:

    • Develop potassium-sensitive fluorescent indicators to monitor channel function

    • Create cell lines with stable expression of KCNK18 variants

    • Use membrane potential dyes to indirectly measure channel activity

    • Implement in 96 or 384-well plate formats for high-throughput screening

  • CRISPR-based variant libraries:

    • Generate libraries of KCNK18 variants using CRISPR base editing

    • Pair with cellular phenotypes that reflect channel function

    • Use single-cell RNA-seq to link variant expression to downstream effects

    • Develop machine learning algorithms to predict functional consequences

  • Yeast-based functional complementation:

    • Engineer yeast strains where growth depends on functional K+ channel activity

    • Express KCNK18 variants and assess growth as proxy for function

    • Enable rapid screening of numerous variants simultaneously

These approaches would significantly accelerate variant classification and improve our understanding of structure-function relationships in KCNK18, facilitating more accurate genetic counseling and personalized therapeutic strategies .

What therapeutic strategies might target TRESK channels for neurological disorders?

Several therapeutic strategies targeting TRESK channels show promise for treating KCNK18-associated disorders:

  • Channel activators:

    • Develop compounds that enhance TRESK activity

    • Counteract loss-of-function in haploinsufficient conditions

    • Potential utility in migraine prophylaxis and epilepsy management

    • May compensate for partial channel dysfunction in compound heterozygotes

  • Gene therapy approaches:

    • Deliver functional KCNK18 gene to affected neurons

    • Use AAV vectors for targeted delivery to trigeminal ganglia or specific brain regions

    • Apply CRISPR-based strategies to correct pathogenic variants

    • Develop antisense oligonucleotides to silence dominant-negative variants

  • Compensatory ion channel modulation:

    • Target other K2P channels co-expressed with TRESK

    • Enhance activity of TREK or TASK channels to compensate for TRESK dysfunction

    • Develop combination therapies targeting multiple channel types

    • Modulate downstream voltage-gated channels to normalize excitability

  • Pathway-specific interventions:

    • Target calcineurin-dependent regulation pathway

    • Develop compounds that bypass specific regulatory defects

    • Design interventions specific to particular variant mechanisms

    • Exploit structural knowledge of TRESK for rational drug design

The development of such therapeutic approaches requires detailed understanding of variant-specific mechanisms and careful consideration of potential off-target effects in the complex landscape of neuronal excitability regulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.