Recombinant Human Potassium channel subfamily K member 4 (KCNK4)

Shipped with Ice Packs
In Stock

Description

Functional Studies

  • Mechanosensitivity: Recombinant KCNK4 channels exhibit robust activation under membrane stretch, with low activation thresholds and broad tension responsiveness .

  • Neuroprotection: Activation by arachidonic acid reduces neuronal excitability, offering protection against ischemic brain injury .

  • Disease-Associated Mutations:

    • Variants like p.Ala172Glu and p.Ala244Pro impair mechanosensitivity and increase basal K⁺ conductance, linked to neurodevelopmental disorders .

    • Mutations in KCNK4 are associated with FHEIG syndrome (facial dysmorphism, hypertrichosis, epilepsy, intellectual delay, and gingival overgrowth) .

Clinical Relevance

  • Epilepsy: Dysregulated KCNK4 function alters resting membrane potentials, contributing to Rolandic epilepsy and spontaneous seizures .

  • Pain Perception: KCNK4 modulates nociception by regulating sensory neuron excitability in dorsal root ganglia .

Drug Development

  • KCNK4 is a target for volatile anesthetics, antidepressants, and neuroprotective agents .

  • Studies show trichloroethanol (a sedative metabolite) activates TREK-1/TRAAK channels, suggesting roles in CNS inhibition .

Disease Modeling

  • Recombinant KCNK4 enables functional studies of mutations linked to epilepsy and neurodevelopmental disorders .

  • Used to explore mechanisms in cerebral ischemia, cardiac arrhythmias, and pulmonary hypertension .

Biotechnology Tools

  • Antibody Development: Custom anti-KCNK4 antibodies are generated for immunohistochemistry and Western blotting .

  • Ion Channel Reconstitution: Services like Creative Biolabs’ Magic™ platform produce KCNK4 in lipid bilayers for electrophysiological assays .

Key Challenges and Future Directions

  • Expression Stability: Maintaining functional integrity during recombinant production remains technically demanding .

  • Therapeutic Targeting: Developing subtype-specific modulators for KCNK4 is complicated by structural similarities within the K2P family .

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any specific requirements for the format, please indicate your preference when placing the order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
KCNK4; TRAAK; Potassium channel subfamily K member 4; TWIK-related arachidonic acid-stimulated potassium channel protein; Two pore potassium channel KT4.1; Two pore K(+ channel KT4.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNK4
Target Protein Sequence
MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGL LIKEVADALGGGADPETNSTSNSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFC IFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGC LLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWIL LGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPPEKE QPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCP LPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV
Uniprot No.

Target Background

Function
KCNK4 (TRAAK) is a voltage-insensitive potassium channel. Channel opening is triggered by mechanical forces that deform the membrane. Channel opening is also triggered by raising the intracellular pH to basic levels. The channel is inactive at 24 degrees Celsius (in vitro); raising the temperature to 37 degrees Celsius increases the frequency of channel opening, with further enhancement in channel activity when the temperature is raised to 42 degrees Celsius. TRAAK plays a role in the perception of pain caused by heat. It also contributes to the sensory perception of pain caused by pressure.
Gene References Into Functions
  1. Functional alanine-mutagenesis screens of TASK-1 and TRAAK were used to build an in silico model of the TASK-1 cap. PMID: 26794006
  2. KCNK4 promoter methylation is associated with Breast Cancer. PMID: 25809865
  3. How ion channels sense mechanical force: insights from mechanosensitive K2P channels TRAAK, TREK1, and TREK2. PMID: 26332952
  4. Findings uncover a unique aspect of potassium channel modulation, indicating a means for how the channel C-terminal cytoplasmic domain affects the C-type gate, and suggesting how lipids and bilayer inner leaflet deformations gate the channel. PMID: 25500157
  5. TRAAK is responsive to mechanical forces similar to the ion channel Piezo1; mechanical activation of TRAAK can electrically counter Piezo1 activation. PMID: 24550493
  6. The structure reveals a domain-swapped chain connectivity enabled by the helical cap that exchanges two opposing outer helices 180 degrees around the channel PMID: 23341632
  7. Crystal structure of TRAAK at 3.8 angstroms resolution; the channel comprises 2 protomers that create a 2-fold symmetric K(+) channel; the extracellular surface has a helical cap; 2 diagonally opposed gate-forming inner helices form membrane-interacting structures PMID: 22282805
  8. Role for TREK-1 in contributing to uterine quiescence during gestation PMID: 20811500
  9. Human TASK-3 was cloned and expressed; protein sequence and activity compared to similar two pore domain potassium channels, including KCNK4 (TRAAK). PMID: 11042359

Show More

Hide All

Database Links

HGNC: 6279

OMIM: 605720

KEGG: hsa:50801

STRING: 9606.ENSP00000378033

UniGene: Hs.647233

Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is KCNK4 and what are its basic functional properties?

KCNK4 (potassium channel subfamily K member 4) belongs to the TWIK-related arachidonic acid-stimulated two pore potassium channel subfamily, also known as TRAAK or K2P4.1 . This channel functions as a homodimer forming an outwardly rectifying potassium channel that contributes to the resting membrane potential and cellular excitability . It plays a critical role in regulating neuronal excitability through its influence on the resting membrane potential .

The channel exhibits several distinctive regulatory characteristics, being modulated by polyunsaturated fatty acids, temperature changes, and mechanical deformation of the lipid membrane . KCNK4 is predominantly expressed in neural tissues and may participate in regulating the noxious input threshold in dorsal root ganglia neurons .

What is the typical expression pattern of KCNK4 across tissues and developmental stages?

KCNK4 shows predominant expression in neuronal tissues, which aligns with its functional role in neuronal excitability . Expression patterns can be analyzed using data from the GTEx database for adult non-disease tissues and the Brainspan database for developmental expression across multiple brain regions .

Analysis of human RNA-seq data across developmental stages (from 8 post-conceptional weeks to 40 years) reveals specific temporal expression patterns in various brain regions . These expression profiles are typically normalized to reads per kilobase million (RPKM), and expression splines are fitted using the locally weighted scatterplot smoothing (LOWESS) algorithm to interpret developmental expression patterns .

What expression systems are most effective for recombinant KCNK4 production?

Human embryonic kidney 293 (HEK293) cells have been demonstrated as an effective expression system for recombinant human KCNK4 production . When expressing the protein in HEK293 cells, the recombinant KCNK4 can be fused with tags such as Myc/DDK at the C-terminus to facilitate detection and purification .

For experimental protocols involving electrophysiological studies, transfection of HEK293 cells with human KCNK4 cDNA (typically at concentrations of 400 ng/mL or 80 ng/mL as final concentration) can be performed using Lipofectamine 2000 . Co-expression assays may use 80 ng/mL of each channel plasmid, resulting in a total of 160 ng/mL channel cDNA .

What are the optimal buffer conditions and storage parameters for recombinant KCNK4?

Based on established protocols, recombinant human KCNK4 protein is optimally maintained in a buffer composed of 25 mM Tris.HCl (pH 7.3), 100 mM glycine, and 10% glycerol . This formulation helps preserve the structural integrity and functional properties of the protein.

The recombinant protein typically has a molecular mass of approximately 42.5 kDa and should be produced to a purity of >80% as determined by SDS-PAGE and Coomassie blue staining . For research applications, a concentration of >50 μg/mL (as determined by microplate BCA method) is generally recommended .

What patch-clamp configurations are optimal for studying KCNK4 channel properties?

Different patch-clamp configurations offer unique advantages for investigating specific KCNK4 properties. For basic characterization of channel function without mechanical stimulation, the whole-cell mode is recommended as it exerts no tension on the cell membrane . In this configuration, wild-type KCNK4 typically exhibits outward-rectifying currents that become evident at positive potentials .

To specifically investigate the mechanosensitivity of KCNK4 channels, outside-out experiments are more appropriate . In this configuration, wild-type KCNK4 channels can be activated by positive pressure applied through the patch pipette, with activation effects often increasing with repetitive stimulation and time . Maximal activation can result in current amplitude increases of up to a hundredfold compared to initial values .

How can I differentiate between wild-type and mutant KCNK4 channel activities electrophysiologically?

Wild-type and mutant KCNK4 channels display distinctive electrophysiological signatures that can be identified through careful analysis of current-voltage relationships and mechanosensitive responses.

In whole-cell recordings, wild-type KCNK4 channels show outward-rectifying currents that become apparent primarily at positive potentials . In contrast, mutant channels (such as p.Ala244Pro or p.Ala172Glu) generate significantly larger currents that are already prominent in the negative potential range . Notably, p.Ala244Pro KCNK4 channels mostly lack the voltage-dependent initial current increase typically seen in wild-type channels, instead resembling maximally stimulated wild-type KCNK4 channels .

For quantitative comparison, voltage ramps can be used to evaluate current amplitude at 0 mV and conductance at −80 mV . Expression of mutant KCNK4 channels, as well as their co-expression with wild-type KCNK4, results in significantly increased current amplitudes compared to wild-type channels alone, demonstrating the dominant impact of these mutations .

What methodologies are most effective for assessing the functional impact of KCNK4 variants?

A comprehensive approach to assessing KCNK4 variant pathogenicity should combine multiple methodologies:

  • Electrophysiological studies: Patch-clamp recordings in whole-cell and outside-out configurations can reveal altered channel properties, such as changes in current amplitude, voltage dependence, and mechanosensitivity .

  • In silico analysis: Multiple prediction tools should be employed to assess conservation and potential functional impacts. Meta in silico predictors like Alphamissense, Bayesdelnoaf, Revel, and Phylop100way have demonstrated excellent performance in distinguishing pathogenic/likely pathogenic variants .

  • Population frequency analysis: Analysis of minor allele frequency (MAF) in population databases is crucial. Pathogenic variants typically show significantly lower MAF compared to variants of uncertain significance and benign variants .

  • Protein modeling: Structural modeling can identify alterations in hydron bonds, protein flexibility, and potential gain-of-function or loss-of-function effects .

How do mutations in KCNK4 affect its mechanosensitivity?

Mutations in KCNK4 can profoundly alter its mechanosensitive properties. Wild-type KCNK4 channels demonstrate robust activation in response to positive pressure applied through the patch pipette during outside-out experiments . This mechanical activation can increase current amplitudes up to a hundredfold of the initial value .

In contrast, KCNK4 mutants like p.Ala244Pro and p.Ala172Glu exhibit significantly impaired pressure sensitivity . Pressure-induced changes in current amplitude are typically absent in p.Ala244Pro KCNK4 channels, while p.Ala172Glu mutants show only small increases in current amplitude with pressure application . These findings suggest that these mutations cause constitutive activation of the channel, reducing or eliminating its responsiveness to mechanical stimuli.

Coexpression of wild-type and p.Ala172Glu KCNK4 channels results in slightly more pronounced pressure-induced channel activation compared to p.Ala172Glu alone, but the effects remain significantly smaller than for wild-type channels .

What is the spectrum of phenotypes associated with KCNK4 variants?

KCNK4 variants have been associated with a range of neurological phenotypes, from relatively mild epilepsy to severe syndromic neurodevelopmental disorders . The phenotypic spectrum appears to include:

  • FHEIG syndrome: A recognizable syndrome with a distinctive facial gestalt, hypertrichosis, and epilepsy .

  • Epilepsy with febrile seizures plus (EFS+): Some patients exhibit typical EFS+ with partial features of FHEIG, including neurodevelopmental abnormalities and hypertrichosis, but without facial dysmorphism and gingival overgrowth .

  • Rolandic epilepsy: Identified as a milder phenotype associated with KCNK4 variants .

The emergence of this phenotypic spectrum suggests that KCNK4 is potentially a novel causative gene for various epilepsy types, which has implications for genetic diagnosis and clinical management of affected patients .

How can researchers distinguish pathogenic from benign KCNK4 variants?

Distinguishing pathogenic from benign KCNK4 variants requires an integrated approach that considers multiple lines of evidence:

  • Minor allele frequency (MAF): Pathogenic/likely pathogenic variants typically show significantly lower MAF compared to variants of uncertain significance (P = 0.0004) and benign/likely benign variants (P < 0.0001) . Pathogenic variants are often absent from population databases, reflecting selection pressure against these variants .

  • Meta in silico predictors: Advanced algorithms like Alphamissense, Bayesdelnoaf, Revel, and Phylop100way demonstrate excellent performance in distinguishing pathogenic/likely pathogenic variants .

  • Conservation analysis: Pathogenic variants often affect highly conserved residues across diverse species, which can be assessed through amino acid sequence alignment .

  • De novo occurrence: Many pathogenic KCNK4 variants occur de novo, which is a strong indicator of pathogenicity (PS2 criterion in ACMG guidelines) .

What experimental designs are most effective for studying KCNK4 interactions with lipids and other modulators?

KCNK4 belongs to the TRAAK/TREK subfamily of K2P channels that are sensitive to certain lipids . To study these interactions, researchers should consider the following experimental approaches:

  • Lipid reconstitution studies: Purified KCNK4 can be reconstituted into artificial lipid bilayers with defined compositions to systematically evaluate the effects of specific lipids on channel function.

  • Patch-clamp with lipid application: Outside-out patch-clamp configurations allow direct application of lipids to the membrane patch while monitoring channel activity in real-time.

  • Molecular dynamics simulations: Computer modeling can predict interaction sites between KCNK4 and various lipid molecules, generating hypotheses that can be tested experimentally.

  • Mutagenesis of potential lipid-interacting residues: Targeted mutations of amino acids predicted to interact with lipids can provide insights into the structural basis of lipid modulation.

How can co-expression systems be optimized to study KCNK4 heteromeric channels?

When investigating heteromeric KCNK4 channels or the dominant effects of mutant subunits, co-expression systems require careful optimization:

  • DNA ratio optimization: For co-expression assays, a balanced approach using equal amounts of each channel plasmid (e.g., 80 ng/mL of each, resulting in a total of 160 ng/mL channel cDNA) is typically employed .

  • Tagged constructs: Differentially tagged wild-type and mutant constructs can help distinguish between homomeric and heteromeric channels.

  • Fluorescent protein fusions: Fusion of different fluorescent proteins to wild-type and mutant channels allows visualization of co-localization and trafficking.

  • Electrophysiological fingerprinting: The biophysical properties of heteromeric channels often differ from those of homomeric channels, providing a functional readout of co-assembly.

What are the current limitations in KCNK4 research methodologies?

Despite significant advances, several methodological challenges remain in KCNK4 research:

  • Rarity of variants: The exceptional rarity of KCNK4 variants makes large cohort studies challenging, limiting our understanding of the complete phenotypic spectrum .

  • Functional validation: Many variants' functional effects are predicted through in silico analysis but lack experimental verification. For instance, the gain-of-function effects of variants like p.Gly139Arg require experimental confirmation beyond computational predictions .

  • Correlation limitations: Establishing causal links between spatiotemporal expression of KCNK4 and specific phenotypic features requires additional research beyond current correlation data .

  • Heteromeric channel complexity: The potential for KCNK4 to form heteromeric channels with other K2P family members adds complexity that is difficult to address with current methods.

What emerging technologies might advance our understanding of KCNK4 biology?

Several cutting-edge approaches hold promise for advancing KCNK4 research:

  • CRISPR-based technologies: Genome editing in cellular and animal models can provide more physiologically relevant contexts for studying KCNK4 function and dysfunction.

  • Single-cell electrophysiology combined with transcriptomics: This approach could reveal how KCNK4 function varies across neuronal subtypes and correlates with gene expression profiles.

  • Cryo-electron microscopy: High-resolution structural studies of KCNK4 in different conformational states could provide insights into channel gating mechanisms and the molecular basis of mechanosensitivity.

  • Patient-derived induced pluripotent stem cells (iPSCs): Differentiation of patient-specific iPSCs into neurons allows investigation of KCNK4 variants in human neuronal contexts with relevant genetic backgrounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.