Recombinant Human Potassium channel subfamily K member 5 (KCNK5)

Shipped with Ice Packs
In Stock

Description

Introduction to KCNK5

Potassium channel subfamily K member 5 (KCNK5) belongs to the superfamily of potassium channel proteins containing two pore-forming P domains . Also known as K2P5.1, TASK-2, or TASK2, this protein is encoded by the KCNK5 gene located on human chromosome 6 . KCNK5 forms functional dimers in cell membranes and is characterized by four transmembrane domains and two pore-forming loops that create the conduction pathway for potassium ions .

One of the most notable features of KCNK5 is its high sensitivity to external pH, which, in combination with its predominant expression in the cortical distal tubules and collecting ducts of the kidney, suggests it plays a crucial role in renal potassium transport and acid-base balance regulation . This pH sensitivity makes KCNK5 particularly important in physiological contexts where pH fluctuations occur, such as in the renal system.

Protein Structure

The human KCNK5 protein consists of 499 amino acids forming a complex membrane-spanning structure . The protein contains multiple functional domains, most notably the two pore-forming P domains that define the K2P channel family . These pore domains create the ion conduction pathway through which potassium ions selectively pass across the cell membrane.

The full protein sequence of KCNK5 includes various functional regions responsible for channel gating, potassium selectivity, and regulation by factors such as pH and membrane tension . The protein exhibits outward rectification characteristics, preferentially allowing potassium ions to flow out of the cell rather than into it, which is crucial for its physiological functions in maintaining potassium homeostasis .

Available Recombinant Forms

Several recombinant forms of human KCNK5 have been developed for research purposes:

  1. Human KCNK5 (aa 342-414) Control Fragment Recombinant Protein: This fragment represents a portion of the KCNK5 protein and shows highest antigen sequence identity to mouse and rat orthologs at 75% . It is particularly useful for blocking experiments with corresponding antibodies.

  2. Full-length Human KCNK5 protein (AA 1-499) with Strep Tag: Produced using cell-free protein synthesis (CFPS), this recombinant protein encompasses the entire amino acid sequence of KCNK5 and is suitable for various applications including Western blotting, ELISA, and SDS-PAGE .

Table 1: Characteristics of Recombinant KCNK5 Products

Recombinant KCNK5 ProductAmino AcidsTagProduction SystemApplications
Human KCNK5 Control Fragment342-414Not specifiedNot specifiedBlocking experiments with antibodies, IHC/ICC, WB
Full-length Human KCNK51-499Strep TagCell-free protein synthesis, Tobacco (Nicotiana tabacum)Western Blotting, ELISA, SDS-PAGE

Tissue Distribution

KCNK5 exhibits a specific expression pattern, with predominant expression in the cortical distal tubules and collecting ducts of the kidney . This localization aligns with its proposed role in renal potassium transport and acid-base balance regulation, particularly given the channel's sensitivity to external pH fluctuations .

Beyond renal tissues, KCNK5 has been detected in various other cell types, including T lymphocytes, where its expression is significantly upregulated upon T cell activation . Additionally, KCNK5 is expressed in corneal epithelial cells, with upregulation observed in dry eye conditions .

Role in Cellular Volume Regulation

One of the key physiological functions of KCNK5 is its involvement in cellular volume regulation, particularly in the process known as regulatory volume decrease (RVD). This mechanism allows cells to reduce their volume following swelling caused by hypotonic conditions.

In Ehrlich cells, KCNK5 has been identified as the volume-sensitive potassium channel responsible for facilitating potassium efflux during RVD . Research has shown that long-term exposure to hypotonic conditions (24-48 hours) results in functional down-regulation of KCNK5, with a significant decrease in protein expression observed after 48 hours of hypotonicity, but not after 24 hours . This down-regulation impairs the RVD response, suggesting dynamic regulation of KCNK5 expression and function in response to prolonged osmotic challenges.

In T lymphocytes, the role of KCNK5 in volume regulation appears more complex. Despite significant up-regulation of KCNK5 at both mRNA (after 24 hours) and protein levels (72 and 144 hours) upon T cell activation via CD3/CD28 stimulation, the RVD response in these activated T cells is inhibited . This inhibition is primarily attributed to a decreased chloride permeability in activated T cells, which prevents the coordinated efflux of potassium and chloride ions necessary for efficient RVD .

Table 2: KCNK5 Expression and Function in Different Cell Types

Cell TypeKCNK5 Expression PatternFunctional RoleResearch Findings
Renal Tubular CellsHigh in cortical distal tubules and collecting ductsRenal potassium transportHighly sensitive to external pH
T LymphocytesUpregulated upon CD3/CD28 activationPossibly in membrane hyperpolarizationUp-regulated at mRNA (24h) and protein (72-144h) levels despite inhibited RVD
Ehrlich CellsExpressed and functionalVolume-sensitive K+ channel in RVDDown-regulated upon long-term hypotonicity (48h)
Corneal Epithelial CellsUpregulated in dry eye conditionsPotassium efflux, pyroptosis inductionSilencing KCNK5 mitigates pyroptosis in dry eye models

KCNK5 in Dry Eye Disease

Recent research has highlighted the importance of KCNK5 in ocular pathology, particularly in dry eye disease. Studies have demonstrated that KCNK5 is upregulated in both in vivo and in vitro models of dry eye . Gene set enrichment analysis revealed an upregulation of potassium channel activity in desiccation stress conditions, with KCNK5 showing the most pronounced upregulation among the KCNK family genes .

The overexpression of KCNK5 in corneal epithelial cells has been shown to induce potassium efflux and activate the NLR family pyrin domain containing 3 (NLRP3) inflammasome, leading to pyroptosis, a form of inflammatory cell death . This finding establishes a direct link between KCNK5 function and inflammatory processes in the corneal epithelium during dry eye conditions.

Importantly, silencing KCNK5 effectively mitigates pyroptosis in dry eye models, suggesting a potential therapeutic approach for this common ocular condition . Additionally, KCNK5 overexpression has been found to downregulate TNF superfamily member 10 (TNFSF10), resulting in the impairment of autophagy . Supplementation with TNFSF10 can promote autophagy and mitigate pyroptosis in dry eye, suggesting a complex interplay between KCNK5, TNFSF10, autophagy, and pyroptosis in the pathogenesis of dry eye disease .

KCNK5 in Immune Function

In T lymphocytes, KCNK5 is highly up-regulated following activation with CD3/CD28, suggesting a role in immune cell function beyond volume regulation . It has been hypothesized that KCNK5 up-regulation in activated T cells might play a role in membrane hyperpolarization, which could lead to increased calcium influx and subsequently support T cell proliferation .

KCNK5 has also been reported to be up-regulated in T cells from multiple sclerosis patients, indicating a potential role in autoimmune pathology . This finding, together with the observed up-regulation in activated T cells, suggests that KCNK5 may be involved in both normal immune responses and autoimmune disorders.

Experimental Applications

Recombinant KCNK5 proteins serve as valuable tools in research aimed at understanding the structure, function, and regulation of this important potassium channel. The Human KCNK5 (aa 342-414) Control Fragment Recombinant Protein is particularly useful for blocking experiments with corresponding antibodies in techniques such as immunohistochemistry, immunocytochemistry, and Western blotting .

For blocking experiments, it is recommended to use a 100x molar excess of the protein fragment control based on the concentration and molecular weight, with pre-incubation of the antibody-protein control fragment mixture for 30 minutes at room temperature . This approach allows for specific validation of antibody binding and helps confirm the identity of KCNK5 in experimental samples.

The full-length recombinant KCNK5 protein with Strep Tag is produced through cell-free protein synthesis and purified using one-step affinity chromatography . This product is reported to typically retain enzymatic functionality, making it suitable for various research applications including functional studies, protein-protein interaction analyses, and structural investigations .

Therapeutic Potential

The understanding of KCNK5's role in various physiological and pathological processes opens avenues for therapeutic development. For instance, in dry eye disease, strategies aimed at silencing or inhibiting KCNK5 could potentially mitigate pyroptosis and alleviate symptoms . The direct relationship between KCNK5 overexpression, potassium efflux, NLRP3 inflammasome activation, and pyroptosis provides a clear mechanistic pathway that could be targeted therapeutically.

Similarly, modulating KCNK5 function in T cells might offer approaches for addressing certain autoimmune conditions where T cell hyperactivation is a concern, given the upregulation of KCNK5 in activated T cells and in T cells from multiple sclerosis patients .

Pharmacological agents affecting KCNK5 expression or function may already exist. For example, pilocarpine has been reported to increase the expression of KCNK5 protein in rat models , suggesting that existing drugs might influence KCNK5 activity, potentially offering repurposing opportunities.

Table 3: Basic Characteristics of Human KCNK5

CharacteristicDetails
Protein NamePotassium channel subfamily K member 5 (KCNK5)
Alternative NamesK2P5.1, TASK-2, TASK2, KCNK5b
Gene ID (Human)8645
UniProt IDO95279
Chromosome LocationChromosome 6
Protein Length499 amino acids
Key DomainsTwo pore-forming P domains
Main Expression SitesCortical distal tubules and collecting ducts of the kidney
Key PropertyHigh sensitivity to external pH

Recent Advances

Recent research has expanded our understanding of KCNK5 beyond its traditional role in kidney function. The discovery of its involvement in dry eye pathogenesis through potassium efflux and pyroptosis induction represents a significant advancement in ocular surface disease research . Similarly, the elucidation of KCNK5's role in T cell physiology, particularly its upregulation following activation despite an inhibited volume regulatory response, has provided new insights into immune cell function .

Studies on the long-term regulation of KCNK5 in response to osmotic challenges have revealed complex patterns of expression and functional adaptation . The finding that KCNK5 is functionally down-regulated upon long-term hypotonicity in Ehrlich cells, predominantly due to decreased protein synthesis, highlights the dynamic nature of KCNK5 regulation in response to environmental conditions .

Future Research Directions

Several promising areas for future KCNK5 research include:

  1. Detailed structural studies to facilitate the design of specific modulators with potential therapeutic applications.

  2. Further investigation of KCNK5's roles in various physiological and pathological processes beyond the kidney, immune system, and ocular surface.

  3. Exploration of KCNK5 as a biomarker or therapeutic target in conditions ranging from kidney disorders to autoimmune diseases and ocular pathologies.

  4. Development of specific pharmacological modulators of KCNK5 function for experimental and potentially therapeutic purposes.

  5. Investigation of the interplay between KCNK5 and other ion channels or transporters in coordinated cellular responses.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery timelines may vary depending on the purchase method and location. We recommend consulting your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for arrangement and associated charges.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCNK5; TASK2; Potassium channel subfamily K member 5; Acid-sensitive potassium channel protein TASK-2; TWIK-related acid-sensitive K(+ channel 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-499
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
KCNK5
Target Protein Sequence
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKI LEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL FGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPF VFMVTEGWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQVKGSTASKDVNIFSFLSKKEET YNDLIKQIGKKAMKTSGGGETGPGPGLGPQGGGLPALPPSLVPLVVYSKNRVPTLEEVSQ TLRSKGHVSRSPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLIFQDASI TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSESTFTSTESELS VPYEQLMNEYNKANSPKGT
Uniprot No.

Target Background

Function
This protein is a pH-dependent, voltage insensitive, outwardly rectifying potassium channel. The outward rectification is lost at high external K(+) concentrations.
Gene References Into Functions
  1. Mutations in the promoter region of the TWIK-related acid-sensitive K(+) channel 2 (TASK-2) gene did not lead to hypertension or primary aldosteronism (PA) during long-term follow-up in healthy participants. These findings suggest that these mutations alone do not appear to be a contributing factor to PA. PMID: 29293917
  2. This research highlights a potential role for KCNK5 in regulating platelet size and maturity. Furthermore, the findings confirm an association between the SH2B3-locus and platelet count. PMID: 28865245
  3. In human aldosterone-producing adrenocortical cancer cell lines, roxithromycin effectively inhibited KCNJ5MUT-induced induction of CYP11B2 (encoding aldosterone synthase) expression and aldosterone production. PMID: 28604387
  4. While HLA-DQB1*06:02 does not seem to be associated with hypoxic ventilatory response or hypercapnic ventilatory response, there are statistically significant associations (uncorrected) between two TASK2/KCNK5 variants (rs2815118 and rs150380866) and hypercapnic ventilatory response. PMID: 28045995
  5. These research findings provide valuable insights into the potential pathophysiological effects of this missense variant in TASK-2. PMID: 27228168
  6. While upregulated KCNK5 in activated human T cells does not appear to play a volume regulatory role due to decreased Cl- permeability, the upregulation may contribute to hyperpolarization of the cell membrane, ultimately leading to increased Ca2+ influx and T cell proliferation. PMID: 26909737
  7. Potassium channel TASK2 plays a crucial role in human NK-cell proliferation and cytolytic function. PMID: 26140335
  8. Mutant genes (CELA1, HSPG2, and KCNK5) identified in Balkan endemic nephropathy patients encode proteins involved in basement membrane/extracellular matrix and vascular tone, elements closely linked to the process of angiogenesis. PMID: 24949484
  9. Lower expression of the TASK-2 channel is a characteristic of aldosterone-producing adenoma causing aldosteronism and is associated with higher expression of hsa-miR-23 and hsa-miR-34. PMID: 24285684
  10. Potassium channels, particularly K2P channels, are expressed and functional in the apical membrane of airway epithelial cells. PMID: 21964404
  11. Disease activity in rheumatoid arthritis patients correlates strongly with K(2P)5.1 expression levels in CD4+ T lymphocytes in the peripheral blood. PMID: 21314928
  12. 17beta-estradiol induces the expression of KCNK5 via ERalpha(+) in breast cancer cells, and this channel plays a significant role in regulating proliferation in these cell lines. PMID: 21680658
  13. Research suggests that the cytokine receptor-coupled JAK/STAT pathway is upstream of the swelling-induced phosphorylation and activation of TASK-2 in Ehrlich ascites tumor cells. PMID: 20631251
  14. K2P5.1 has been identified as a critical player in T-cell effector function. Selective targeting of K(2P)5.1 holds therapeutic promise for multiple sclerosis and potentially other T-cell-mediated disorders. PMID: 20582984
  15. TASK-2 lacks a histidine residue at the homologous position. Introduction of such a residue did not result in the expected increase in pH sensitivity; instead, a slight decrease was observed. PMID: 12634929
  16. TASK-2 is not highly expressed in the cerebellum. PMID: 15197476
  17. KCNK5 is involved in K(+)-channel activity during regulatory volume decrease in human spermatozoa. Channel activity is regulated beyond the level of protein expression. PMID: 18157847

Show More

Hide All

Database Links

HGNC: 6280

OMIM: 603493

KEGG: hsa:8645

STRING: 9606.ENSP00000352527

UniGene: Hs.444448

Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Abundant expression in kidney, also detected in liver, placenta and small intestine. In the kidney, expression is restricted to the distal tubules and collecting ducts. Not expressed in proximal tubules or glomeruli.

Q&A

What is KCNK5 and where is it typically expressed?

KCNK5 is a pH-sensitive two-pore domain potassium channel expressed in multiple tissues including liver, pancreas, small intestine, and kidney. It belongs to the broader family of potassium channels that regulate cellular membrane potential and ion homeostasis . KCNK5 currents demonstrate specific electrophysiological properties, including outward rectification and lack of inactivation when recorded in whole-cell patch-clamp configurations .

How is KCNK5 activity regulated by pH?

KCNK5 channels are distinctively regulated by pH changes on either side of the cellular membrane. The channel is activated by alkaline intra- or extracellular pH and inhibited by acidic pH conditions . This pH sensitivity makes it particularly relevant in physiological contexts where pH regulation is critical, such as in the kidney where KCNK5 participates in controlling HCO₃⁻ excretion . This pH-dependent modulation provides researchers with a useful functional marker to identify and characterize KCNK5 activity in experimental settings.

What are the standard methods for modulating KCNK5 activity in experimental models?

For experimental modulation of KCNK5, researchers can employ several approaches:

Pharmacological modulation:

  • KCNK5 is insensitive to classical potassium channel blockers such as tetraethylammonium (TEA) and 4-aminopyridine

  • The channel is inhibited by quinidine and the antiarrhythmic agent clofilium at micromolar concentrations

Genetic modulation:

  • siRNA-mediated knockdown has been successfully employed to reduce KCNK5 expression

  • Multiple transfection protocols have been described, typically showing functional effects after 6 days of treatment

pH modulation:

  • Altering extracellular or intracellular pH provides a physiological means to regulate channel activity

  • In patch-clamp studies, pH changes can be used to identify the KCNK5-specific component of recorded currents

What are the recommended approaches for studying KCNK5 in cell culture models?

When investigating KCNK5 in cellular models, researchers should consider:

Cell line selection:

  • T47D and MCF-7 breast cancer cell lines have demonstrated significant KCNK5 expression and functional responses

  • These models are particularly useful for studying estrogen-mediated regulation of KCNK5

Transfection protocols:

  • For knockdown studies, a multiple-transfection protocol over 6 days has shown efficacy

  • When performing transient transfections, co-expression of GFP allows identification of successfully transfected cells

Functional assessment:

  • Whole-cell patch-clamp recording remains the gold standard for functional characterization

  • pH-sensitive currents with outward rectification and no inactivation are characteristic of KCNK5 channels

  • Proliferation assays can detect functional consequences of KCNK5 modulation, particularly in hormone-responsive cells

How can I design effective siRNA experiments to study KCNK5 function?

Effective siRNA experiments targeting KCNK5 require careful consideration of several factors:

siRNA design and validation:

  • Target sequences should be specific to KCNK5 with minimal off-target effects

  • Validation should include qRT-PCR to confirm knockdown efficiency at the mRNA level

  • Western blotting or immunofluorescence can confirm protein reduction

Transfection protocols:

  • For sustained knockdown, multiple transfections over 6 days have proven effective in previous studies

  • When analyzing proliferation effects, synchronize cells before treatment to better observe cell cycle-specific impacts

Controls:

  • Include both non-targeting siRNA controls and mock transfection controls

  • For rescue experiments, consider co-expressing siRNA-resistant KCNK5 constructs

Functional readouts:

  • Cell viability (trypan blue exclusion can assess whether effects are due to reduced proliferation or increased cell death)

  • Flow cytometry for cell cycle analysis can determine if KCNK5 knockdown induces G1/S arrest

  • Patch-clamp electrophysiology to directly measure changes in pH-sensitive currents

How does KCNK5 contribute to cell cycle regulation and proliferation?

KCNK5 plays a significant role in cell cycle progression, particularly in estrogen-responsive cells:

Cell cycle effects:

  • Knockdown of KCNK5 in T47D cells induces G1/S cell cycle arrest

  • Flow cytometry analysis shows that KCNK5 knockdown causes a significantly higher proportion of cells to remain in G1 phase compared to controls (p = 0.0015 at 12h, p = 0.012 at 18h, and p = 0.032 at 24h of estrogen treatment)

Proliferation impact:

  • KCNK5 knockdown reduces basal proliferation modestly

  • More pronounced inhibition occurs in estrogen-stimulated proliferation

  • This effect appears to be due to cell cycle arrest rather than increased cell death, as trypan blue exclusion studies show no significant difference in cell viability between control siRNA (29 ± 6%) and KCNK5 siRNA (36 ± 9%, p = 0.377)

Mechanistic considerations:

  • KCNK5 may influence proliferation through regulation of membrane potential

  • Effects on intracellular calcium concentration, cell volume, and possibly intracellular pH have been proposed as mechanisms

What is the relationship between KCNK5 and inflammation-related cell death (pyroptosis)?

Recent research has revealed a novel role for KCNK5 in inflammatory processes, particularly pyroptosis:

KCNK5 in pyroptosis pathway:

  • Overexpression of KCNK5 induces potassium efflux, which activates the NLRP3 inflammasome

  • This activation leads to pyroptosis, an inflammatory form of programmed cell death

Disease relevance:

  • In dry eye disease models, KCNK5 is upregulated in both in vivo and in vitro systems

  • Silencing KCNK5 effectively mitigates pyroptosis in these models

Molecular interactions:

  • KCNK5 overexpression results in downregulation of TNF superfamily member 10 (TNFSF10)

  • This downregulation impairs autophagy, which may contribute to enhanced pyroptotic responses

  • Supplementation with TNFSF10 promotes autophagy and mitigates pyroptosis in dry eye models

How should I interpret conflicting electrophysiological data from KCNK5 experiments?

When facing contradictory electrophysiological results in KCNK5 research, consider these methodological factors:

pH considerations:

  • Ensure consistent pH control in solutions, as small variations can significantly affect KCNK5 activity

  • Both intracellular and extracellular pH influence channel function, so both must be carefully controlled

Expression level variations:

  • Transient transfection can lead to variable expression levels between experiments

  • Consider stable cell lines for more consistent expression when comparing experimental conditions

Channel localization:

  • KCNK5 may have functions in intracellular compartments beyond the plasma membrane

  • Subcellular localization should be assessed, as mistargeting of potassium channels (as observed in some cancer cells) can affect experimental outcomes

Experimental temperature:

  • Temperature affects channel kinetics and should be consistently controlled and reported

  • Room temperature recordings (22-23°C) are commonly used, but physiological temperature may provide different results

What evidence links KCNK5 to cancer pathophysiology?

Multiple lines of evidence suggest KCNK5 involvement in cancer:

Genomic amplification:

  • A novel amplicon on 6p21.2 containing KCNK5 (along with KCNK16 and KCNK17) has been identified in primary human cancers and cancer cell lines

  • Upregulation of KCNK5 transcripts has been observed in several cancer cell lines

Hormone-responsive cancers:

  • In breast cancer models, KCNK5 is upregulated by estrogen via estrogen receptor α (ERα)

  • This upregulation contributes to estrogen-stimulated cell proliferation

Cell cycle effects:

  • KCNK5 knockdown induces G1/S cell cycle arrest in breast cancer cells

  • This effect is particularly pronounced in estrogen-stimulated conditions

Family members in cancer:

  • The related channel KCNK9 is amplified in 10% of breast tumors and overexpressed in 44%

  • This pattern suggests a broader role for two-pore domain potassium channels in cancer biology

How can KCNK5 be targeted in dry eye disease models?

Based on recent findings linking KCNK5 to dry eye pathophysiology, several experimental approaches can be considered:

Genetic targeting:

  • siRNA-mediated silencing of KCNK5 has been effective in mitigating pyroptosis in dry eye models

  • This suggests therapeutic potential for KCNK5 inhibition in this condition

Downstream pathway modulation:

  • TNFSF10 supplementation promotes autophagy and reduces pyroptosis

  • This provides an alternative approach to mitigate the downstream effects of KCNK5 overexpression

Potassium efflux inhibition:

  • Since potassium efflux is a key mechanism by which KCNK5 contributes to corneal epithelial pyroptosis, compounds that inhibit this process may have therapeutic potential

  • Channel blockers specific to KCNK5 could be developed as targeted interventions

Inflammasome targeting:

  • Inhibitors of NLRP3 inflammasome activation may provide an approach to block the downstream effects of KCNK5-mediated potassium efflux

  • This represents an indirect but potentially effective strategy

What are the recommended controls and statistical approaches for KCNK5 expression studies?

When analyzing KCNK5 expression data, researchers should implement:

Experimental controls:

  • For siRNA experiments: non-targeting siRNA controls with similar GC content

  • For overexpression studies: empty vector controls

  • For pharmacological studies: vehicle controls at equivalent concentrations

Statistical considerations:

  • For comparing two groups: Student's unpaired t-test (as used in previous KCNK5 studies)

  • For multiple group comparisons: ANOVA with appropriate post-hoc tests

  • Report exact p-values rather than thresholds (e.g., p = 0.015 rather than p < 0.05)

Data presentation:

  • Include individual data points alongside means and standard deviations/errors

  • For time-course experiments (such as cell proliferation), show complete curves rather than selected time points

  • For cell cycle analysis, present comprehensive cell distribution data across all phases

How can I accurately measure and distinguish KCNK5-specific currents in electrophysiological experiments?

To isolate and characterize KCNK5-specific currents:

pH manipulation approach:

  • Utilize the pH sensitivity of KCNK5 to identify channel-specific currents

  • Record baseline currents at neutral pH, then alter extracellular pH to isolate the pH-sensitive component

  • KCNK5 currents will show characteristic outward rectification and no inactivation

Pharmacological isolation:

  • KCNK5 is insensitive to classical potassium channel blockers (TEA and 4-aminopyridine)

  • It is inhibited by quinidine and clofilium

  • Use these pharmacological properties to distinguish KCNK5 currents from other potassium currents

Genetic verification:

  • Confirm the identity of recorded currents using siRNA knockdown of KCNK5

  • The pH-sensitive component should be significantly reduced following effective knockdown

  • Rescue experiments with KCNK5 expression constructs can provide additional verification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.