Recombinant Human Potassium channel subfamily K member 6 (KCNK6)

Shipped with Ice Packs
In Stock

Description

Production Systems

Recombinant KCNK6 is expressed in multiple platforms:

  • HEK293 cells: Preferred for proper post-translational modifications

  • E. coli: Used for high-yield production of tag-free protein

  • Mammalian cell lines: Maintain native channel functionality

  • Baculovirus-insect cell systems: Alternative for structural studies

Functional Properties

Key biophysical characteristics:

  • Conductance: <5 pS at physiological conditions

  • Thermal sensitivity: Inactivated at >35°C

  • pH response: Retains 64% activity at pH 6.4

  • Pharmacological profile:

    • Inhibited by volatile anesthetics

    • Potentiated by arachidonic acid

    • Modulated by PKC/PKA pathways

Electrophysiological comparison:

ParameterKCNK6 vs Other K2P Channels
InactivationTime-dependent at depolarization
Baseline ActivityHigher resting membrane influence
Thermal ResponseUnique heat inactivation profile

Cancer Biology

  • Breast cancer: Overexpression increases proliferation (3.2×), invasion (2.8×), and migration in MDA-MB-231 cells

  • Mechanistic role:

    • Reduces cell stiffness (ΔYoung's modulus = -1.7 kPa)

    • Decreases intercellular adhesion (45% reduction vs controls)

    • Promotes epithelial-mesenchymal transition

Cardiovascular Research

  • Pulmonary hypertension models: 62% reduction in TWIK-2 expression correlates with vascular remodeling

  • Blood pressure regulation: Knockout models develop hypertension

Neurological Studies

  • DFNA4 hearing loss: Identified as candidate gene through cochlear expression mapping

  • Pain pathways: Modulates inflammatory pain responses

Clinical Correlations

Disease associations:

ConditionKCNK6 Expression ChangeClinical Impact
Breast cancer4.7× upregulatedReduced 5-year survival (HR=2.1)
Sickle cell anemiaSNP rs57294264Vaso-occlusive crisis severity
Pulmonary arterial HTN58% downregulationRight ventricular hypertrophy

Technical Considerations

Experimental validation:

  • Immunohistochemistry: Scoring system combines intensity (1-3) and distribution (1-4)

  • Electrophysiology: Requires temperature-controlled patch clamp setups

  • Knockdown protocols: Lentiviral shRNA achieves 72% silencing efficiency

Common vectors:

  • pcDNA6/myc-His C for mammalian expression

  • pET-28a(+) for bacterial production

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCNK6; TOSS; TWIK2; Potassium channel subfamily K member 6; Inward rectifying potassium channel protein TWIK-2; TWIK-originated similarity sequence
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNK6
Target Protein Sequence
MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALD AFVERVLAAGRLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK AFSIAFALLGVPTTMLLLTASAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVV VTVCFLVPAVIFAHLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTV YLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQL SASSHTDYASIPR
Uniprot No.

Target Background

Function
Exhibits outward rectification in a physiological K(+) gradient and mild inward rectification in symmetrical K(+) conditions.
Gene References Into Functions
  1. Identification and characterization of Kcnk6 expression within the mammalian cochlea established the gene as a functional candidate for DFNA4. PMID: 14689445
Database Links

HGNC: 6281

OMIM: 603939

KEGG: hsa:9424

STRING: 9606.ENSP00000263372

UniGene: Hs.240395

Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widespread expression, detected in all tissues tested except for skeletal muscle. Strongest expression in placenta, pancreas, heart, colon and spleen, lower levels detected in peripheral blood leukocytes, lung, liver, kidney and thymus. Lowest expression

Q&A

What is KCNK6 and which protein family does it belong to?

KCNK6 belongs to the potassium channel subfamily K, also known as the two-pore-domain potassium channel (K2P) family. This family comprises 15 members collectively known as "leak channels" that exhibit Goldman-Hodgkin-Katz (open) rectification. The name derives from their unique structure consisting of four membrane-spanning domains and two pore-forming loops per subunit . As a background potassium channel, KCNK6 facilitates the leakage of potassium ions out of cells, primarily regulating the resting membrane potential and cellular life processes .

Where is KCNK6 naturally expressed in human tissue?

Expression studies have detected several KCNK family members, including KCNK6, throughout multiple body systems including the cardiovascular, central nervous, gastrointestinal, and genitourinary systems . Research has demonstrated differential expression patterns of KCNK6 between normal and cancerous tissues, with significant upregulation observed in breast cancer tissues compared to normal breast tissue . This differential expression pattern makes KCNK6 particularly interesting for researchers studying cancer biology and potential therapeutic targets.

What are the main physiological functions of KCNK6?

KCNK6, like other K2P channels, contributes to a variety of physiological functions. These include regulation of cardiac rhythm, mechanical stress response, blood pressure modulation, neuroprotection, and sensation of oxygen tension, taste, and temperature . Many neurotransmitters and neuromodulators act via G protein-coupled receptors to close KCNK channels, thereby regulating neuronal activity . Recent research has also highlighted its potential role in cancer biology, particularly in affecting cell adhesion and hardness properties that influence malignant cell behavior .

What experimental methods are most effective for studying KCNK6 overexpression in cancer models?

For studying KCNK6 overexpression in cancer models, researchers have successfully employed the following methodological approach:

  • Vector selection and construction: The pcDNA6/myc-His C vector has proven effective as both a control empty vector and for creating a KCNK6 overexpression vector. After annealing, the CDS fragment of KCNK6 can be inserted into the vector by matching the viscous ends of EcoRI and NotI to obtain the overexpression vector .

  • Transfection procedure: Breast cancer cells (such as MDA-MB-231 and MCF-7) can be plated overnight and then transfected with the KCNK6 overexpression vector or control empty vector using Neofect transfection reagent in OptiDMEM medium .

  • Validation of expression: The relative expression level of KCNK6 should be verified using real-time quantitative PCR with KCNK6-specific primers. Researchers have successfully used the sequence: KCNK6-F, 5′-CTAAACCCCTCCTGTGTGCT-3′; KCNK6-R, 5′-CAACACCTCACCTCCTCCAT-3′; with GAPDH as a control .

This experimental approach allows for controlled investigation of the effects of KCNK6 overexpression on cellular phenotypes including proliferation, invasion, and migration capabilities.

How can researchers effectively develop KCNK6 knockdown models?

To develop effective KCNK6 knockdown models, researchers should follow this methodological approach:

  • Vector selection: Choose appropriate shRNA vectors targeting KCNK6 along with empty control vectors.

  • Transfection and virus production: Transfect 293T cells with either the shRNA or empty control vectors and incubate. After approximately 60 hours, harvest the culture medium containing virus particles with the shRNA .

  • Infection and selection: Use the harvested virus particles to infect breast cancer cell lines. Select cells with successfully knocked down KCNK6 using puromycin .

  • Validation: Confirm knockdown efficiency through real-time quantitative PCR and/or Western blotting to ensure significant reduction in KCNK6 expression levels.

This approach enables the creation of stable knockdown cell lines for investigating the functional significance of KCNK6 in various cellular processes and comparison with overexpression models.

What are the key experimental design considerations when investigating KCNK6's role in cell adhesion and hardness properties?

When investigating KCNK6's effect on cell adhesion and hardness properties, consider these critical experimental design elements:

  • Control and variable groups: Establish clearly defined experimental groups (KCNK6 overexpression, knockdown, and appropriate controls) to isolate the specific effects of KCNK6 on cellular biophysical properties .

  • Measurement techniques:

    • For cell adhesion: Implement standardized adhesion assays that quantitatively measure the attachment strength of cells to substrates.

    • For cell hardness: Utilize atomic force microscopy or similar techniques to measure cellular mechanical properties with precision .

  • Statistical validity: Design experiments with sufficient biological and technical replicates to ensure statistical significance (minimum n=3 for each experimental condition).

  • Time-course analysis: Include time-course measurements to capture dynamic changes in adhesion and hardness properties following KCNK6 modulation.

  • Correlative endpoints: Simultaneously measure other phenotypic characteristics (migration, invasion) to correlate changes in biophysical properties with functional outcomes .

Research has demonstrated that high levels of KCNK6 decrease the adhesion and hardness of breast cancer cells, while its knockdown increases these properties, suggesting a direct relationship between KCNK6 expression and cellular biophysical phenotypes that influence cancer progression .

How should researchers analyze KCNK6 expression data from public databases for cancer studies?

When analyzing KCNK6 expression data from public databases for cancer studies, researchers should follow this methodological framework:

  • Database selection and data extraction:

    • Utilize established databases such as Gene Expression Omnibus (GEO) and The Cancer Genome Atlas (TCGA)

    • Select appropriate datasets with sufficient sample sizes of both normal and cancer tissues

    • Example datasets successfully used in previous studies include:

      • GSE42568 (17 normal breast tissues, 104 breast cancer tissues)

      • GSE10780 (143 normal breast tissues, 42 breast cancer tissues)

      • GSE53752 (25 normal breast tissues, 51 breast cancer tissues)

  • Data normalization and quality control:

    • Apply appropriate normalization methods to minimize batch effects

    • Filter datasets for quality control (remove low-quality samples or outliers)

    • Validate findings across multiple independent datasets to ensure reliability

  • Statistical analysis:

    • Perform differential expression analysis using appropriate statistical tests

    • Consider clinical parameters (tumor stage, grade, patient demographics) in the analysis

    • Establish significance thresholds with multiple testing correction (e.g., Benjamini-Hochberg)

  • Correlation analysis:

    • Analyze correlations between KCNK6 expression and clinical outcomes

    • Perform multivariate analysis to control for confounding factors

This approach has successfully identified significant upregulation of KCNK6 in breast cancer, which was subsequently validated through laboratory experiments .

What scoring methods are recommended for quantifying KCNK6 expression in immunohistochemistry studies?

For quantifying KCNK6 expression in immunohistochemistry studies, researchers should implement the following standardized scoring system:

  • Signal strength scoring:

    • Light yellow: Score 1

    • Brown: Score 2

    • Brown with non-specific staining: Score 3

  • Percentage scoring (proportion of tumor cells showing KCNK6 signaling):

    • 0-25%: Score 1

    • 26-50%: Score 2

    • 51-75%: Score 3

    • 75%: Score 4

  • Final score calculation:

    • Multiply signal strength score by percentage score

    • Final score = Signal strength score × Percentage score

  • Expression level classification:

    • Final score of 0: Negative expression

    • Final score ≤3: Low expression

    • Final score >3: High expression

This scoring method provides a quantitative approach for evaluating KCNK6 expression levels in tissue samples, allowing for statistical comparison between different tissue types and correlation with clinical parameters.

What are the common challenges in producing recombinant KCNK6 protein, and how can they be addressed?

Producing recombinant KCNK6 protein presents several challenges due to its membrane protein nature. Here are the key challenges and recommended solutions:

  • Protein folding and stability issues:

    • Challenge: Maintaining proper folding and stability of the four membrane-spanning domains and two pore-forming loops

    • Solution: Utilize specialized membrane protein production platforms with optimized expression conditions and stabilizing agents

  • Expression system selection:

    • Challenge: Identifying the most effective expression system for functional KCNK6

    • Solution: Consider multiple expression systems including bacterial (E. coli), yeast (P. pastoris), insect cells (Sf9, Sf21), and mammalian cells (CHO, HEK293) to determine optimal yield and functionality

  • Purification complexity:

    • Challenge: Extraction and purification while maintaining native conformation

    • Solution: Employ advanced membrane protein production platforms with various strategies including:

      • Detergent micelles

      • Proteoliposomes

      • Nanodiscs

      • MP-VLPs (membrane protein virus-like particles)

      • Polymers

      • Stable cell lines

  • Functional validation:

    • Challenge: Ensuring the recombinant protein retains physiological activity

    • Solution: Implement functional assays specific to potassium channel activity, such as patch-clamp electrophysiology or ion flux assays

Implementing these solutions can significantly improve the quality and yield of recombinant KCNK6 protein for research applications.

How can researchers verify the specificity of antibodies used in KCNK6 detection?

To verify the specificity of antibodies for KCNK6 detection, researchers should implement this comprehensive validation approach:

  • Positive and negative controls:

    • Positive controls: Use tissues or cell lines with confirmed high KCNK6 expression

    • Negative controls: Include tissues with minimal KCNK6 expression and perform antibody omission controls

    • Knockdown/knockout validation: Test antibodies on KCNK6 knockdown or knockout samples to confirm specificity

  • Cross-reactivity assessment:

    • Test antibodies against related K2P family members (especially those with high sequence homology)

    • Perform Western blot analysis to confirm detection of protein at the expected molecular weight

  • Multi-technique validation:

    • Validate antibody performance across multiple detection techniques:

      • Western blotting

      • Immunohistochemistry/immunofluorescence

      • Flow cytometry

      • ELISA

    • Compare results between techniques to ensure consistent detection patterns

  • Epitope mapping:

    • Identify the specific epitope recognized by the antibody

    • Ensure the epitope is unique to KCNK6 and not conserved among other K2P family members

This systematic approach ensures reliable detection of KCNK6 in experimental systems, minimizing false positive and false negative results.

Based on current research, what are the most promising therapeutic applications targeting KCNK6 in cancer?

Based on current research, the most promising therapeutic applications targeting KCNK6 in cancer include:

  • Small molecule inhibitors:

    • Development of specific KCNK6 channel blockers to inhibit the proliferation, invasion, and migration of cancer cells

    • Potential for combination therapy with existing chemotherapeutics to enhance efficacy

  • RNA interference-based therapies:

    • siRNA or shRNA delivery systems targeting KCNK6 expression, based on successful knockdown experiments showing reversal of malignant phenotypes

    • Nanoparticle-mediated delivery to enhance targeted distribution to cancer cells

  • Antibody-based approaches:

    • Development of antibodies specifically targeting KCNK6 extracellular domains

    • Potential for antibody-drug conjugates to deliver cytotoxic agents directly to KCNK6-overexpressing cells

  • Diagnostic applications:

    • Utilization of KCNK6 expression as a biomarker for cancer progression and potential treatment response

    • Development of imaging techniques using labeled KCNK6 antibodies for cancer detection

These approaches are supported by research demonstrating that KCNK6 knockdown can reverse the enhanced proliferation, invasion, and migration capabilities of breast cancer cells, suggesting its potential as a therapeutic target .

What experimental design would best evaluate the effect of KCNK6 modulation on treatment resistance in cancer?

An optimal experimental design to evaluate KCNK6 modulation effects on treatment resistance would include:

  • In vitro experimental setup:

    GroupKCNK6 StatusTreatment Condition
    1Wild-typeVehicle control
    2Wild-typeChemotherapy agent
    3OverexpressedVehicle control
    4OverexpressedChemotherapy agent
    5KnockdownVehicle control
    6KnockdownChemotherapy agent
  • Cell line selection:

    • Use multiple breast cancer cell lines with varying baseline KCNK6 expression

    • Include both treatment-sensitive and treatment-resistant cell lines

    • Consider patient-derived organoids or primary cultures for higher clinical relevance

  • KCNK6 modulation approach:

    • Generate stable KCNK6 overexpression cell lines using the pcDNA6/myc-His C vector system

    • Create KCNK6 knockdown models using validated shRNA constructs

    • Consider inducible expression systems to evaluate temporal effects

  • Treatment resistance assays:

    • Dose-response curves to determine IC50 values for various chemotherapeutic agents

    • Long-term culture under drug selection to develop resistance models

    • Colony formation assays following drug treatment

    • Apoptosis and cell death measurements using flow cytometry

  • Mechanistic investigations:

    • Evaluate changes in membrane potential and ion homeostasis

    • Assess alterations in drug efflux pump activity

    • Analyze cell adhesion and hardness properties in relation to drug penetration

    • Investigate changes in apoptotic pathway activation

  • In vivo validation:

    • Xenograft models using modulated cell lines

    • Treatment with standard chemotherapy regimens

    • Monitoring of tumor growth, metastasis, and survival

This comprehensive experimental design would provide robust data on how KCNK6 modulation affects treatment resistance, potentially identifying new strategies to overcome resistance mechanisms in cancer therapy.

What bioinformatic approaches can researchers use to identify potential regulatory mechanisms of KCNK6 expression in cancer?

To identify potential regulatory mechanisms of KCNK6 expression in cancer, researchers should employ these bioinformatic approaches:

  • Transcriptional regulation analysis:

    • Promoter region analysis for transcription factor binding sites

    • ChIP-seq data mining to identify transcription factors that bind the KCNK6 promoter

    • Correlation analysis between transcription factor expression and KCNK6 levels across cancer datasets

  • Epigenetic regulation investigation:

    • DNA methylation analysis of KCNK6 promoter and enhancer regions

    • Histone modification patterns (H3K27ac, H3K4me3, etc.) at the KCNK6 locus

    • Chromatin accessibility analysis using ATAC-seq data

  • Post-transcriptional regulation:

    • miRNA target prediction for KCNK6 mRNA

    • RNA-binding protein interaction prediction

    • Alternative splicing analysis using RNA-seq data

  • Pathway and network analysis:

    • Integration with signaling pathway databases (KEGG, Reactome)

    • Protein-protein interaction network construction

    • Co-expression network analysis to identify functionally related genes

  • Multi-omics data integration:

    • Correlation between genomic alterations (copy number, mutations) and KCNK6 expression

    • Integration of transcriptomic, proteomic, and phosphoproteomic data

    • Single-cell analysis to identify cell-type specific regulation

These bioinformatic approaches can reveal the complex regulatory mechanisms governing KCNK6 expression in cancer, potentially identifying novel targets for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.