Recombinant Human Potassium channel subfamily K member 7 (KCNK7)

Shipped with Ice Packs
In Stock

Description

Challenges in Recombinant Expression and Functional Studies

Efforts to produce functional recombinant KCNK7 face significant hurdles:

  • Lack of standalone activity: No currents have been recorded in heterologous systems, even after mutagenesis or fusion strategies to address retention .

  • Co-factor dependency: Hypothesized to require non-pore-forming partners for membrane localization, similar to other "silent" K2P subunits like TASK-5 and TALK-1 .

  • Species-specific differences: Mouse KCNK7 contains a C-terminal EF-hand domain absent in humans, complicating cross-species comparisons .

Insights from Knockout Models

Studies in KCNK7 knockout mice reveal:

  • No overt phenotype: Homozygous knockouts show normal development, weight, and behavior compared to wildtypes .

  • Anesthetic resistance: Minimum alveolar concentration (MAC) for volatile anesthetics (e.g., isoflurane) remains unchanged, suggesting KCNK7 does not critically mediate anesthetic effects .

  • Compensation mechanisms: Redundancy among K2P channels likely masks functional deficits in knockouts .

Potential Biological Roles and Disease Associations

While direct evidence for recombinant KCNK7 is limited, endogenous KCNK7 has been implicated in:

  • Central nervous system (CNS) function: Detected in cerebral cortex, hippocampus, and choroid plexus, potentially influencing cerebrospinal fluid dynamics .

  • Cancer progression: Correlated with immune cell infiltration (e.g., CD8+ T cells) in breast cancer, though its mechanistic role remains unclear .

  • Taste signaling: Listed in pathways like "Sweet Taste Signaling," though functional contributions are unconfirmed .

Research Gaps and Future Directions

  • Identification of cofactors: Proteomic studies are needed to identify binding partners enabling KCNK7 trafficking.

  • Structural resolution: Cryo-EM or X-ray crystallography could clarify how the GLE motif impacts ion selectivity.

  • Disease modeling: Engineered cell lines expressing recombinant KCNK7 with putative partners may elucidate roles in cancer or neurological disorders .

Current Status in Biomedical Research

KCNK7 remains understudied relative to other K2P channels:

  • Drug discovery: No known activators/inhibitors or clinical trials target KCNK7 .

  • Omics data: Pharos classifies KCNK7 as a "dark target" with minimal annotation (Pubmed score: 2.53; 0 Gene RIFs) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement when placing the order. We will prepare accordingly to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCNK7; Potassium channel subfamily K member 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNK7
Target Protein Sequence
MGGLRPWSRYGLLVVAHLLALGLGAVVFQALEGPPACRLQAELRAELAAFQAEHRACLPP GALEELLGTALATQAHGVSTLGNSSEGRTWDLPSALLFAASILTTTGYGHMAPLSPGGKA FCMVYAALGLPASLALVATLRHCLLPVLSRPRAWVAVHWQLSPARAALLQAVALGLLVAS SFVLLPALVLWGLQGDCSLLGAVYFCFSSLSTIGLEDLLPGRGRSLHPVIYHLGQLALLG YLLLGLLAMLLAVETFSELPQVRAMGKFFRPSGPVTAEDQGGILGQDELALSTLPPAAPA SGQAPAC
Uniprot No.

Target Background

Function
Probable potassium channel subunit. No channel activity has been observed in vitro as the protein remains in the endoplasmic reticulum. It may need to associate with an as-yet unidentified partner to reach the plasma membrane.
Database Links

HGNC: 6282

OMIM: 603940

KEGG: hsa:10089

STRING: 9606.ENSP00000344820

UniGene: Hs.175218

Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is KCNK7 and how does it differ from other K2P family members?

KCNK7 (Potassium Two Pore Domain Channel Subfamily K Member 7) is a member of the superfamily of potassium channel proteins containing two pore-forming P domains. Unlike most other K2P channels that function as background "leak" channels establishing resting membrane potential, KCNK7 has not demonstrated functional channel activity in vitro. This is primarily because the protein remains sequestered in the endoplasmic reticulum rather than trafficking to the plasma membrane .

The distinguishing feature of KCNK7 is its classification as an "electrically silent" channel, meaning it doesn't produce measurable currents under standard experimental conditions. Current evidence suggests KCNK7 may require association with currently unidentified non-pore-forming proteins to reach the plasma membrane and potentially exhibit channel functionality .

What is the genomic organization and expression profile of KCNK7?

KCNK7 is encoded by a gene located on chromosome 11 (based on previous GeneCards identifiers including GC11M067876, GC11M067042, etc.). The gene produces multiple transcript variants encoding different isoforms , suggesting complex transcriptional regulation.

The gene is identified by several external database identifiers:

  • HGNC: 6282

  • NCBI Gene: 10089

  • Ensembl: ENSG00000173338

  • OMIM: 603940

  • UniProtKB/Swiss-Prot: Q9Y2U2

While detailed tissue-specific expression data isn't provided in the search results, understanding expression patterns is crucial for contextualizing KCNK7 function in specific physiological systems.

What diseases have been associated with KCNK7 dysfunction?

Current research indicates that KCNK7 has been associated with two primary pathological conditions:

  • Adrenal Cortical Adenocarcinoma: While the specific mechanistic involvement of KCNK7 isn't detailed in the search results, this association aligns with broader patterns observed in other K2P channels, many of which show altered expression in various cancers .

  • Birk-Barel Syndrome: Though primarily associated with mutations in KCNK9 (another K2P family member), KCNK7 has also been linked to this maternally inherited disorder characterized by mental retardation, hypotonia, and facial dysmorphism .

How do K2P channels generally contribute to disease pathophysiology?

K2P channels can contribute to disease through several mechanisms:

  • In cancer: K2P channels modulate cell proliferation, metastasis, and apoptosis. Various K2P channels show differential expression patterns across cancer types. For instance, KCNK5, KCNK9, and KCNK2 upregulation has been associated with triple-negative breast cancer, which has poor prognosis .

  • In neurological disorders: K2P channels regulate neuronal excitability and contribute to neurodevelopmental processes. Mutations in K2P channels can lead to disorders like FHEIG (Facial dysmorphism, Hypertrichosis, Epilepsy, Intellectual disability, Gingival overgrowth) and Birk-Barel Mental Retardation Syndrome .

  • In cardiovascular diseases: K2P channels modulate electrical activity in cardiac cells. Changes in channel expression or function have been observed in conditions such as atrial fibrillation and heart failure .

Why is KCNK7 difficult to study as a functional channel and what approaches might overcome these limitations?

The primary challenge in studying KCNK7 is its retention in the endoplasmic reticulum rather than trafficking to the plasma membrane where ion channel function could be assessed . This phenomenon may explain why no channel activity has been observed in vitro despite its structural similarity to other functional K2P channels.

Potential methodological approaches to overcome this limitation include:

  • Identification of trafficking partners: Research suggests KCNK7 "may need to associate with an as yet unknown partner in order to reach the plasma membrane" . Co-expression studies with candidate interacting proteins could potentially identify factors that facilitate proper membrane localization.

  • Creation of chimeric constructs: Replacing intracellular domains of KCNK7 with corresponding regions from trafficking-competent K2P channels might bypass retention signals.

  • Use of trafficking enhancers: Chemical chaperones or compounds that modulate endoplasmic reticulum quality control might rescue membrane expression.

  • Advanced imaging techniques: Super-resolution microscopy combined with fluorescently-tagged KCNK7 could help visualize subcellular localization and potential dynamic trafficking events.

What expression systems are most appropriate for recombinant KCNK7 studies?

While the search results don't provide specific recommendations for KCNK7 expression systems, we can extrapolate from general practices in K2P channel research:

  • Mammalian cell lines: Chinese Hamster Ovary (CHO) cells have been used to study other K2P channels like TALK2 , and might be suitable for KCNK7. Human cell lines (HEK293, COS-7) that possess mammalian-specific chaperones and trafficking machinery could also be considered.

  • Xenopus oocytes: This system has been used for expression of other K2P channels like TALK2 and might potentially be suitable for KCNK7, particularly when co-expressing with candidate auxiliary proteins.

  • Inducible expression systems: Given the potential challenges with KCNK7 expression, tetracycline-inducible or similar regulated systems might allow better control over expression levels and timing.

The choice of expression system should consider factors such as post-translational modification requirements, endogenous K2P channel expression, and compatibility with downstream analytical methods.

What electrophysiological approaches are most suitable for investigating potential KCNK7 activity?

Since KCNK7 has not shown functional channel activity in standard conditions, innovative electrophysiological approaches may be necessary:

  • Patch-clamp techniques: While conventional whole-cell and single-channel patch-clamp recordings have not detected KCNK7 activity, these remain essential tools if trafficking solutions are developed. High-resolution techniques might detect subtle conductance changes.

  • Automated high-throughput electrophysiology: Platforms like Qpatch or SyncroPatch could allow screening of multiple conditions (pH, mechanical stimulus, temperature variations) that might activate KCNK7.

  • Fluorescence-based assays: Membrane potential-sensitive dyes or potassium-sensitive fluorescent indicators could provide alternatives to direct electrical recording, potentially allowing detection of subtle functional changes.

  • Reconstitution in artificial membranes: Purified KCNK7 incorporated into lipid bilayers might reveal functional properties not observable in cellular systems.

How can protein-protein interactions of KCNK7 be effectively studied?

Understanding KCNK7's interactions is crucial, particularly given evidence that it may require partner proteins for proper function:

  • Co-immunoprecipitation: Traditional approach to identify interacting proteins, though care must be taken with membrane proteins like KCNK7.

  • Proximity labeling approaches: BioID or APEX2 fusion proteins could identify proteins in close proximity to KCNK7 within the cellular environment.

  • FRET/BRET analysis: Fluorescence or bioluminescence resonance energy transfer can detect direct interactions and conformational changes in living cells.

  • Yeast two-hybrid membrane system: Modified for membrane proteins, this could screen for potential interactors.

  • Mass spectrometry-based interactomics: Identifying the complete set of KCNK7-interacting proteins could reveal functional and regulatory networks.

What are the current hypotheses regarding KCNK7's physiological role despite its apparent lack of channel activity?

Several possibilities exist for KCNK7's physiological role:

  • Regulatory subunit function: KCNK7 might modulate the activity of other functional channels without itself conducting ions.

  • Conditional activity: KCNK7 might become active only under specific physiological conditions not yet reproduced experimentally.

  • Sequestration function: KCNK7 could potentially regulate the availability of interacting partners through its retention in the endoplasmic reticulum.

  • Non-canonical functions: Like some other ion channels, KCNK7 might have functions independent of ion conduction, such as scaffolding or signaling.

How does KCNK7 compare to other "electrically silent" potassium channels in terms of research approaches?

The concept of "electrically silent" channels extends beyond KCNK7. From the limited search results available, we see a hint of this in result , which mentions "a versatile functional interaction between electrically silent KV channels" . While details are sparse, this suggests:

  • Comparative analysis: Techniques successful in studying other electrically silent channels might be adaptable to KCNK7 research.

  • Heteromeric assembly studies: Determining whether KCNK7 forms functional heteromeric channels with other K2P family members could reveal conditional activity.

  • Regulatory function exploration: Investigating whether KCNK7 modulates the activity of other channels through direct or indirect interactions.

What bioinformatic approaches can help predict KCNK7 function and regulation?

Given the experimental challenges with KCNK7, computational approaches offer valuable complementary insights:

  • Structural modeling: Homology modeling based on crystal structures of other K2P channels can predict potential conformation and functional sites.

  • Molecular dynamics simulations: Can predict how KCNK7 might respond to various stimuli or mutations.

  • Network analysis: Integrating expression data across tissues and conditions can reveal potential functional associations.

  • Evolutionary analysis: Comparing KCNK7 conservation across species can identify functionally critical regions.

  • Machine learning approaches: Can integrate diverse datasets to predict potential functions, interactions, or disease associations.

How should researchers interpret contradictory findings about KCNK7 function across different experimental systems?

When faced with contradictory findings about KCNK7:

  • Systematically evaluate experimental differences: Expression systems, detection methods, and experimental conditions can dramatically influence results.

  • Consider splice variants: The multiple transcript variants noted for KCNK7 may have different functional properties.

  • Assess protein modification status: Post-translational modifications might explain functional differences between systems.

  • Evaluate cellular context: Endogenous proteins present in different cell types might enable or inhibit KCNK7 function.

  • Develop quantitative models: Mathematical models integrating multiple datasets can sometimes resolve apparent contradictions by identifying conditional dependencies.

What emerging technologies might advance our understanding of KCNK7 biology?

Several cutting-edge approaches hold promise for KCNK7 research:

  • CRISPR/Cas9 genome editing: Creating endogenous tagged versions of KCNK7 or specific mutations can reveal physiological functions.

  • Single-cell transcriptomics: Identifying cell populations with high KCNK7 expression could focus functional studies.

  • Cryo-electron microscopy: Might eventually allow structural determination of KCNK7 alone or in complex with interacting proteins.

  • Optogenetic tools: Light-controlled trafficking or conformation changes could provide temporal control over KCNK7 function.

  • Organ-on-chip technology: Testing KCNK7 function in more physiologically relevant microenvironments.

How can researchers effectively design experiments to address the apparent paradox of KCNK7's evolutionary conservation despite lack of observed channel function?

The evolutionary conservation of KCNK7 suggests functional importance despite the lack of observed channel activity. Research strategies could include:

  • Comparative functional genomics: Examining KCNK7 orthologs across species for functional differences.

  • Loss-of-function studies: CRISPR knockout or knockdown studies in appropriate model systems to identify phenotypes.

  • Rescue experiments: Testing whether human KCNK7 can complement phenotypes in model organisms lacking their endogenous ortholog.

  • Evolutionary rate analysis: Examining whether different domains of KCNK7 show different rates of evolutionary change, potentially identifying functionally critical regions.

  • Tissue-specific functional studies: Focusing on tissues with highest KCNK7 expression or where disease associations have been identified.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.