Recombinant Human Potassium voltage-gated channel subfamily A member 10 (KCNA10)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant KCNA10 is produced using multiple expression platforms:

Table 1: Common Recombinant KCNA10 Variants

Product CodeExpression SystemSpeciesTagAmino Acid RangeMolecular WeightSource
KCNA10-228H E. coliHumanGST1–216 aa~50 kDaCreative BioMart
RFL2429HF E. coliHumanHisFull-length~58 kDaCreative BioMart
CSB-EP619062HU1 E. coliHumanVaries*PartialN/ACusabio
KCNA10-5078HCL HEK293HumanNoneFull-length~58 kDaCreative BioMart

*Tags determined during manufacturing . Mammalian systems (e.g., HEK293) better preserve post-translational modifications .

Renal Physiology

Recombinant KCNA10 studies revealed its role in stabilizing membrane voltage during sodium reabsorption in proximal tubular cells. Knockdown experiments linked rs34970857 (KCNA10 SNP) to chronic kidney disease risk .

Cardiovascular Studies

In vascular smooth muscle cells, KCNA10 regulates vasodilation by modulating membrane potential. BMP-2 upregulates its expression in pulmonary artery cells, influencing apoptosis/proliferation balance .

Sensory Systems

Mouse models with recombinant Kcna10 deletions showed vestibular dysfunction and mild hearing loss, highlighting its importance in inner ear hair cell function .

Technical Considerations

  • Storage: Lyophilized forms stable ≥12 months at -80°C; reconstituted proteins maintain activity for 1 week at 4°C .

  • Antibody Compatibility: Anti-KCNA10 antibodies (e.g., Covalab pab0295-P) show cross-reactivity with mouse/rat orthologs .

  • Functional Assays: Requires lipid bilayer reconstitution for electrophysiological studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments are delivered with standard blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCNA10; Potassium voltage-gated channel subfamily A member 10; Voltage-gated potassium channel subunit Kv1.8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-511
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNA10
Target Protein Sequence
MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKILISESTNHE TAFSKLPGDYADPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLSQFPETLLGDREKRMQ FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDIFADEISFYELGSEAMDQFR EDEGFIKDPETLLPTNDIHRQFWLLFEYPESSSAARAVAVVSVLVVVISITIFCLETLPE FREDRELKVVRDPNLNMSKTVLSQTMFTDPFFMVESTCIVWFTFELVLRFVVCPSKTDFF RNIMNIIDIISIIPYFATLITELVQETEPSAQQNMSLAILRIIRLVRVFRIFKLSRHSKG LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPGEI ERILNSVGSRMGSTDSLNKTNGGCSTEKSRK
Uniprot No.

Target Background

Function
KCNA10 mediates voltage-dependent potassium ion permeability across excitable membranes. It assumes open or closed conformations in response to changes in the membrane voltage, forming a potassium-selective channel through which potassium ions can pass according to their electrochemical gradient. The channel activity is upregulated by cAMP.
Gene References Into Functions
  1. KCNA10 is expressed in human proximal tubular cells, glomerular and vascular endothelial cells, and also in vascular smooth muscle cells. PMID: 12444201
Database Links

HGNC: 6219

OMIM: 602420

KEGG: hsa:3744

STRING: 9606.ENSP00000358786

UniGene: Hs.248140

Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.8/KCNA10 sub-subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in kidney, in proximal tubules, glomerular endothelium, in vascular endothelium and in smooth muscle cells.

Q&A

What is KCNA10 and what are its key functional roles?

KCNA10, also known as KV1.8, is a potassium channel subunit belonging to the voltage-gated potassium channel (KV1) family. It possesses distinct characteristics that differentiate it from other KV1 family members, including a cyclic nucleotide-binding domain that is unique among KV1 channels . This feature provides potential explanation for the cGMP dependence observed in gK,L (a potassium conductance predominantly found in vestibular hair cells) .

KCNA10 is essential for normal vestibular function. Recent studies have demonstrated that KCNA10 is necessary for several important conductances in vestibular hair cells, including:

  • The large conductance gK,L in type I hair cells

  • Fast-inactivating currents (A-type) in type II hair cells

  • Delayed rectifier currents in type II hair cells

These findings represent a significant breakthrough in understanding vestibular physiology, as the molecular identity of channels underlying these conductances had remained elusive for years .

How is KCNA10 expression distributed in the inner ear?

KCNA10 demonstrates high expression specificity in vestibular sensory epithelia, with particularly strong expression in hair cells . Expression studies have confirmed its presence throughout the vestibular system, with some zonal variation observed across different regions of the utricle (lateral extrastriola, striola, and medial extrastriola) .

Expression analysis has shown that KCNA10 is predominantly localized to vestibular hair cells, with only minor expression reported elsewhere, such as in skeletal muscle and kidney tissue . Within the vestibular system, immunolocalization studies have confirmed the presence of KCNA10 protein in both type I and type II hair cells, supporting electrophysiological data that shows functional importance in both cell types .

What phenotypes are observed in KCNA10 knockout models?

KCNA10 knockout mice (Kcna10–/–) exhibit several distinct physiological phenotypes, though they appear otherwise healthy and develop normally . The most notable findings include:

  • Absent or delayed vestibular-evoked potentials, indicating disruption of the synchronized activity of afferent nerve fibers that respond to fast linear head motions

  • Altered membrane properties in type I hair cells, including dramatically increased input resistance (approximately 44-55 MΩ in wildtype vs. 1400 MΩ in knockout)

  • Significant changes in resting membrane potential in type I hair cells (approximately -84 to -88 mV in wildtype vs. -63 mV in knockout)

  • Reduced membrane capacitance in type I hair cells (approximately 20-30% smaller than in wildtype or heterozygous animals)

The following table summarizes key electrophysiological parameters observed in extrastriolar (ES) type I hair cells across different genotypes:

GenotypeResting Potential (mV)Input Resistance (MΩ)Time Constant (ms)Membrane Capacitance (pF)
Kcna10+/+-84 ± 344 ± 60.24 ± 0.036.1 ± 0.4
Kcna10+/–-88.0 ± 0.755 ± 50.32 ± 0.035.8 ± 0.2
Kcna10–/–-63 ± 21400 ± 1006.4 ± 0.65.0 ± 0.2

These dramatic differences in passive membrane properties underscore the critical importance of KCNA10 in establishing the characteristic electrophysiological profile of vestibular hair cells .

How do KCNA10-mediated currents differ between type I and type II vestibular hair cells?

KCNA10 contributes to distinctly different currents in type I versus type II vestibular hair cells, reflecting its versatile role in vestibular physiology:

In type I hair cells, KCNA10 is essential for the distinctive gK,L conductance, which:

  • Activates at unusually negative potentials (negative to resting potential)

  • Shows little to no inactivation

  • Creates a very low input resistance in mature type I hair cells

  • Produces a hyperpolarized resting potential close to EK

In type II hair cells, KCNA10 contributes to:

  • Fast-inactivating A-type currents

  • Delayed rectifier currents

  • Both currents activate positive to resting potential

  • The A-type component shows rapid voltage-dependent inactivation

Comparative voltage-clamp recordings from Kcna10+/+ and Kcna10–/– mice demonstrate that the elimination of KCNA10 results in the loss of these major conductances in both cell types, revealing a smaller delayed rectifier conductance involving KV7 channels .

Interestingly, the knockout experiments revealed that KCNA10's contribution to type II hair cell currents was previously unrecognized, highlighting its multifaceted role in vestibular physiology .

What methodological approaches are optimal for characterizing KCNA10-mediated currents?

Characterizing KCNA10-mediated currents requires a comprehensive approach combining multiple methodologies:

  • Whole-cell patch-clamp electrophysiology:

    • Voltage-clamp protocols should include both hyperpolarizing and depolarizing steps to capture the full range of activation

    • For type I hair cells, holding potentials should be sufficiently negative (e.g., -100 mV) to deactivate gK,L

    • For type II hair cells, protocols should include analysis of both peak currents (capturing A-type components) and steady-state currents (after A-current inactivation)

  • Conductance-voltage (G-V) relationship analysis:

    • Construct G-V curves for both peak and steady-state currents

    • Analyze key parameters including Vhalf (voltage of half-maximal activation) and slope factor (S)

    • Compare these parameters across different cellular regions and genotypes

  • Pharmacological dissection:

    • Apply KV channel-specific blockers like XE991 (10 μM, selective for KV7 channels) to isolate specific current components

    • Quantify the XE991-sensitive conductance to identify KV7 contributions in both wildtype and Kcna10 knockout preparations

  • Genetic approaches:

    • Compare currents between wildtype, heterozygous, and homozygous knockout animals

    • Analyze age-dependent changes in current properties (from early postnatal to mature stages)

These methodological approaches have revealed that voltage-dependent parameters differ between peak and steady-state currents in type II hair cells, with peak currents showing more positive Vhalf values (~-21 mV vs. ~-26 mV) and greater slope factors (~12 vs. ~9) .

How does KCNA10 interact with other ion channels in vestibular hair cells?

KCNA10 knockout studies have revealed important interactions between KCNA10-dependent conductances and other ion channels in vestibular hair cells:

  • Interaction with KV7 channels:

    • In both Kcna10–/– type I and type II hair cells, a smaller delayed rectifier conductance remains after KCNA10 elimination

    • Pharmacological experiments with 10 μM XE991 (a KV7-selective blocker) revealed that this residual conductance is largely mediated by KV7 family channels

    • The XE991-sensitive conductance (gDR(KV7)) showed similar voltage dependence and maximum conductance density across hair cell types and genotypes

  • Developmental interactions:

    • In immature type I hair cells (P5-P10), which have not yet acquired gK,L, no effects of KCNA10 deletion were observed on delayed rectifier currents

    • This indicates that the delayed rectifier currents in immature type I hair cells are not early forms of KCNA10-dependent gK,L channels

  • Heteromeric channel formation:

    • Differences in current properties between Kcna10+/+ and Kcna10+/– type II hair cells suggest gene dosage effects on the relative numbers of different KV1.8 heteromers

    • Heterozygous cells showed smaller delayed rectifier conductance and faster inactivation than wildtype cells, suggesting the formation of heteromeric channels with varied subunit compositions

These findings highlight the complex interplay between KCNA10 and other ion channels in establishing the distinctive electrophysiological properties of vestibular hair cells.

What factors should be considered when designing expression systems for recombinant human KCNA10?

When designing expression systems for recombinant human KCNA10, researchers should consider several critical factors:

  • Selection of expression system:

    • Heterologous expression systems (HEK293, CHO cells) offer controlled environments but may lack vestibular-specific auxiliary subunits

    • Native-like expression systems (derived from inner ear cells) may better recapitulate physiological behavior but present technical challenges

  • Co-expression considerations:

    • KCNA10 appears to form heteromeric channels in native tissues, suggesting the need to co-express other KV subunits

    • Consider co-expressing auxiliary subunits that might be important for proper channel function in native hair cells

  • Potential modifications required:

    • Include the cyclic nucleotide-binding domain, which is unique to KCNA10 among KV1 channels and may explain cGMP dependence of native currents

    • Consider the effects of protein tags (for purification or visualization) on channel function

  • Functional validation approaches:

    • Compare electrophysiological properties of recombinant channels with native currents

    • Assess sensitivity to cyclic nucleotides, particularly cGMP, which affects native gK,L

    • Evaluate pharmacological profiles using known KV channel modulators

  • Regional variation considerations:

    • Account for potential zonal variations observed in native tissues (lateral extrastriola, striola, medial extrastriola)

    • The voltage dependence of peak currents shows regional differences in native cells, with more positive Vhalf values in lateral extrastriola than striola

  • Gene dosage effects:

    • Consider the impact of expression levels on channel properties, as studies in heterozygous vs. wildtype mice reveal differences in current amplitude and kinetics that may relate to variable heteromeric assembly

These considerations will help ensure that recombinant KCNA10 expression systems adequately model the complex behavior of native channels and enable accurate characterization of channel properties.

What are the common challenges in KCNA10 functional studies and how can they be addressed?

Researchers studying KCNA10 functionality face several common challenges:

  • Distinguishing KCNA10-mediated currents from other KV currents:

    • Challenge: Multiple KV channels may contribute to macroscopic currents in native cells

    • Solution: Combine genetic approaches (Kcna10 knockout) with pharmacological tools (e.g., XE991 for KV7 isolation)

    • Approach: Compare current characteristics before and after specific blockers or in wildtype versus knockout preparations

  • Developmental changes in channel expression:

    • Challenge: KCNA10-dependent currents show significant postnatal development

    • Solution: Carefully control for age in experimental designs

    • Evidence: In wildtype mice, gK,L parameters transition over the first 15-20 postnatal days from conventional delayed rectifier values to mature gK,L values

  • Zonal variations in channel properties:

    • Challenge: Channel properties vary across different regions of vestibular epithelia

    • Solution: Record region-specific data and analyze separately (lateral extrastriola, striola, medial extrastriola)

    • Finding: The voltage dependence of peak currents shows regional differences, with more positive Vhalf values in lateral extrastriola than striola

  • Technical challenges in hair cell recordings:

    • Challenge: Maintaining stable recordings from hair cells with specialized morphology

    • Solution: Optimize recording conditions including solution compositions, temperature control, and recording configurations

    • Consideration: Type I hair cells are partially enclosed by afferent nerve calyces, requiring careful preparation techniques

  • Isolating specific conductance components:

    • Challenge: Separating fast-inactivating (A-type) from sustained components

    • Solution: Employ appropriate voltage protocols (e.g., prepulse inactivation protocols)

    • Analysis: Compare peak currents (capturing A-current plus delayed rectifier) with steady-state currents (after A-current inactivation)

How can researchers effectively analyze KCNA10 function in both in vitro and in vivo systems?

Effective analysis of KCNA10 function requires integrating multiple experimental approaches:

  • In vitro expression systems:

    • Heterologous expression in cell lines (HEK293, CHO)

    • Advantage: Controlled environment for structure-function studies

    • Limitation: May not recapitulate native channel interactions

    • Key measurements: Current amplitudes, voltage dependence, kinetics, pharmacological responses

  • Ex vivo preparations:

    • Acute vestibular epithelium preparations

    • Semi-intact preparations with preserved tissue architecture

    • Measurements: Whole-cell patch-clamp recordings to characterize native currents

    • Analysis: Compare conductance-voltage (G-V) relationships, activation/inactivation kinetics, and pharmacological responses

  • In vivo functional assessments:

    • Vestibular-evoked potentials (VsEPs) measuring synchronized activity of vestibular afferents

    • Behavioral assessments of vestibular function

    • Finding: Kcna10–/– mice show absent or delayed VsEPs, confirming the functional importance of KCNA10 in vestibular signaling

  • Combined genetic and physiological approaches:

    • Compare function across genotypes (wildtype, heterozygous, knockout)

    • Correlate electrophysiological changes with molecular and morphological data

    • Analysis revealed that Kcna10–/– type I hair cells had ~20-30% smaller membrane capacitance than wildtype or heterozygous cells, suggesting effects beyond simple current changes

  • Comprehensive data analysis:

    • Quantify multiple parameters:

      • Membrane properties (resting potential, input resistance, time constant)

      • Current densities (normalizing to cell capacitance)

      • Voltage dependence (Vhalf, slope factor)

      • Kinetic parameters (activation and inactivation time constants)

    • Compare these parameters across genotypes, ages, and vestibular zones

What are the emerging questions regarding KCNA10's role in vestibular physiology?

Several important questions have emerged from recent advances in KCNA10 research:

  • Molecular composition of native KCNA10-containing channels:

    • Do native channels form as homomers or heteromers with other KV subunits?

    • What is the stoichiometry of these channels?

    • How does subunit composition affect channel properties?

    • Evidence suggests variable heteromeric assembly based on differences between Kcna10+/+ and Kcna10+/– currents

  • Regulatory mechanisms:

    • How is KCNA10 regulation linked to cyclic nucleotide signaling via its cyclic nucleotide-binding domain?

    • What is the precise mechanism of cGMP dependence observed in gK,L?

    • Are there vestibular-specific regulatory proteins that modulate KCNA10 function?

  • Developmental regulation:

    • What controls the developmental transition of type I hair cell currents to acquire gK,L properties?

    • How is KCNA10 expression regulated during development?

    • Studies show that gK,L parameters transition over the first 15-20 postnatal days from conventional delayed rectifier values to mature gK,L values

  • Contributions to vestibular signaling:

    • How do KCNA10-mediated currents shape vestibular hair cell receptor potentials?

    • What is the specific contribution of KCNA10 to vestibular afferent signaling?

    • How does KCNA10 dysfunction lead to the observed vestibular phenotypes in knockout models?

  • Regional specialization:

    • What accounts for the zonal variations in KCNA10-dependent currents?

    • How do these regional differences contribute to specialized vestibular functions?

    • Research has shown regional variations in voltage dependence of peak currents, with more positive Vhalf values in lateral extrastriola than striola

How does KCNA10 research impact our understanding of vestibular disorders?

KCNA10 research has important implications for understanding and potentially treating vestibular disorders:

  • Pathophysiological mechanisms:

    • KCNA10 dysfunction could contribute to vestibular disorders characterized by altered hair cell excitability

    • Knockout studies show that KCNA10 loss dramatically affects hair cell membrane properties and disrupts vestibular-evoked potentials

  • Potential therapeutic targets:

    • Understanding KCNA10's role in vestibular function may identify new targets for treating vestibular disorders

    • The unique properties of KCNA10, including its cyclic nucleotide-binding domain, offer potential selective targeting opportunities

  • Diagnostic insights:

    • Knowledge of KCNA10's role may improve diagnostic approaches for vestibular dysfunction

    • The specific phenotypes observed in Kcna10–/– mice could help identify similar conditions in humans

  • Research model validation:

    • The findings in Kcna10–/– mice provide validated models for studying vestibular dysfunction

    • These models can be used to test therapeutic interventions targeting vestibular hair cell function

  • Broader implications for ion channel research:

    • KCNA10's unique properties and essential role in vestibular function highlight the importance of specialized ion channels in sensory systems

    • The discovery that KCNA10 contributes to distinct conductances in different cell types demonstrates the versatility of ion channels in establishing cell-specific properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.