Recombinant Human Potassium voltage-gated channel subfamily C member 1 (KCNC1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant KCNC1 is produced in heterologous expression systems:

SystemHostTagPurityApplications
BacterialE. coliN-terminal His>85% Antibody development, binding assays
MammalianHEK293 cellsFc, Avi>90% Electrophysiology, structural studies

Lyophilized formulations in Tris-HCl (pH 8.0) ensure stability at -20°C for 2–3 years .

Functional and Pharmacological Properties

KCNC1 regulates rapid neuronal repolarization and high-frequency firing . Recombinant versions enable precise studies of its biophysical and pharmacological traits:

PropertyDetail
Channel TypeDelayed rectifier, voltage-gated
InhibitorsTetraethylammonium (TEA; IC₅₀ = 0.2 mM), 4-aminopyridine (4-AP; IC₅₀ = 29 μM)
Key Mutationsp.R320H (associated with progressive myoclonic epilepsy)

Loss-of-function mutations (e.g., Arg320His) disrupt channel activity, leading to epilepsy and ataxia .

Neurological Disease Mechanisms

  • Epilepsy: The p.R320H mutation causes dominant-negative loss of function, impairing repolarization in GABAergic interneurons .

  • Drug Screening: Recombinant KCNC1 is used to test small molecules targeting potassium channelopathies .

Electrophysiological Studies

Recombinant KCNC1 expressed in HEK293 cells facilitates patch-clamp experiments to measure current kinetics and sensitivity to TEA/4-AP .

Key Research Findings

  • Pathway Involvement: KCNC1 participates in the Neuronal System and Voltage-Gated Potassium Channel pathways, interacting with proteins like KCNG3 and KCNV2 .

  • Functional Studies: Kv3.1 conductance enables sustained high-frequency firing in auditory neurons and retinal ganglion cells .

  • Therapeutic Target: Restoring KCNC1 function via gene therapy or pharmacological modulators is being explored for epilepsy treatment .

Challenges and Future Directions

While recombinant KCNC1 has advanced ion channel research, challenges remain in producing full-length, post-translationally modified isoforms. Future work may focus on:

  • Engineering glycosylated forms for native-like function .

  • Developing heterotetrameric channels (e.g., KCNC1/KCNC2) to mimic in vivo conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (incurring additional charges).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
KCNC1; Potassium voltage-gated channel subfamily C member 1; NGK2; Voltage-gated potassium channel subunit Kv3.1; Voltage-gated potassium channel subunit Kv4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-511
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
KCNC1
Target Protein Sequence
MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRH PGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALD SFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALF EDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAE TEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS KAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFA TMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPH HSTQSDTCPLAQEEILEINRAGRKPLRGMSI
Uniprot No.

Target Background

Function

Voltage-gated potassium channel KCNC1 plays a critical role in the rapid repolarization of fast-firing neurons in the brain. Membrane voltage changes trigger channel opening, creating a potassium-selective pore that facilitates potassium ion flux according to its electrochemical gradient. KCNC1 forms functional homotetrameric and heterotetrameric channels, potentially incorporating varying proportions of KCNC2 and other family members. This channel contributes significantly to the sustained high-frequency firing of brief action potentials characteristic of pallidal neurons.

Gene References Into Functions
  1. A recurrent de novo KCNC1 mutation (c.959G>A, p.Arg320His) has been identified as a significant genetic cause of progressive myoclonus epilepsy (PMID: 29428275). This mutation was found in affected brothers exhibiting myoclonus epilepsy and ataxia, with maternal mosaicism suspected.
  2. The KCNC1 p.R320H mutation is associated with MEAK syndrome (PMID: 28380698).
  3. A nonsense KCNC1 variant was identified in three family members with intellectual disability but without seizures (PMID: 28145425).
  4. This review discusses the phenotype/genotype correlations in progressive myoclonus epilepsy and ataxia due to potassium channel mutation (MEAK), specifically focusing on KCNC1 mutations (PMID: 27629860).
  5. KCNC1 generates a resurgent current during repolarization, crucial for action potential termination. This current arises from a combination of steep voltage-dependent gating kinetics and rapid voltage-sensor relaxation (PMID: 26673941).
  6. A recurrent de novo KCNC1 mutation, c.959G>A (p.Arg320His), is a major cause of progressive myoclonus epilepsy, exhibiting a dominant-negative loss-of-function effect (PMID: 25401298).
  7. Studies indicate reduced Kv3.1 channel protein in the neocortex of individuals with schizophrenia, a deficit reversed by antipsychotic drugs (PMID: 23628987).
  8. This study details the localization in the mouse brain of two Kv3.1 isoforms: a longer 'b' isoform and a shorter 'a' isoform (PMID: 12091563).
  9. This publication describes two rat Kv3.1 isoforms: a longer alpha isoform and a shorter beta isoform (PMID: 1432046).
  10. KChIP4a suppresses A-type Kv4 current through ER retention and enhanced Kv4 closed-state inactivation (PMID: 23576435).
  11. While all Kv3 subunit transcripts show significant embryonic expression in whole mouse brain extracts, only Kv3.1, Kv3.2, and Kv3.4 subunit proteins are present (PMID: 21912965).
  12. Glycosylation is essential for DPP10 trafficking to the cell surface and functional interaction with Kv4 channels (PMID: 22387313).
  13. Kv3.1 channels are axonal transported via binding to kinesin I (PMID: 21106837).
Database Links

HGNC: 6233

OMIM: 176258

KEGG: hsa:3746

STRING: 9606.ENSP00000265969

UniGene: Hs.552896

Involvement In Disease
Epilepsy, progressive myoclonic 7 (EPM7)
Protein Families
Potassium channel family, C (Shaw) (TC 1.A.1.2) subfamily, Kv3.1/KCNC1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon. Cell junction, synapse, presynaptic cell membrane.

Q&A

What is the fundamental function of KCNC1 in neuronal physiology?

KCNC1 encodes a voltage-gated potassium channel that plays a critical role in the rapid repolarization of fast-firing brain neurons. The channel opens in response to voltage differences across the membrane, forming a potassium-selective channel through which potassium ions pass according to their electrochemical gradient . This function is particularly important in neurons that generate action potentials at high frequency, including parvalbumin-positive fast-spiking GABAergic inhibitory interneurons (PV-INs) in the cerebral cortex . These PV-INs are crucial for cognitive function and plasticity as well as controlling network excitation to prevent seizures . The channel contributes significantly to sustaining trains of very brief action potentials at high frequency in pallidal neurons .

What are the structural characteristics of KCNC1 channels?

KCNC1 belongs to the 6-transmembrane (6-TM) family of potassium channels. The protein contains a single pore-forming region, and functional channels form as tetramers . The S4 segment serves as the voltage sensor and is characterized by a series of positively charged amino acids at every third position . The C-terminal tail region is important for modulation of channel activity and targeting to specific subcellular compartments . KCNC1 can form both homotetrameric channels and heterotetrameric channels with variable proportions of KCNC2 and possibly other family members . The channel belongs to the Shaw subfamily of the Shaker gene family, which is part of the delayed rectifier class of channel proteins .

How can KCNC1 be experimentally expressed for functional studies?

Recombinant Human KCNC1 protein can be produced for research use in various expression systems. When designing experiments with recombinant KCNC1, researchers should consider:

  • Expression vectors: Select appropriate vectors with strong promoters for neuronal expression.

  • Host systems: Both mammalian cells (for proper post-translational modifications) and bacterial systems can be used depending on experimental goals.

  • Tags and fusion proteins: Consider tags that minimize interference with channel function.

  • Quality control: Verify protein expression through Western blotting and functional testing through electrophysiological recordings .

For cellular localization studies, researchers commonly use fluorescent protein fusions or epitope tags that allow immunocytochemical detection without compromising trafficking or electrophysiological properties .

What disease conditions are associated with KCNC1 dysfunction?

KCNC1 mutations are associated with several neurological disorders:

  • Progressive Myoclonic Epilepsy 7: Characterized by progressive myoclonus, seizures, and neurological deterioration .

  • Developmental and Epileptic Encephalopathy: The Ala421Val (A421V) pathogenic missense variant causes moderate-to-severe developmental delay/intellectual disability and infantile-onset treatment-resistant epilepsy with multiple seizure types including myoclonic seizures .

  • Rett Syndrome: A variant encoding the S474C substitution in Kv3.1 has been associated with developmental regression, stereotypic movements, congenital microcephaly, and epilepsy, meeting the classical criteria for Rett syndrome .

These conditions highlight the critical role of KCNC1 in normal brain development and function, particularly in neurodevelopmental processes and excitability regulation .

What are the mechanisms by which KCNC1 variants cause neurological dysfunction?

Different KCNC1 variants appear to cause neurological dysfunction through distinct mechanisms:

  • The Ala421Val (A421V) variant: This mutation impairs the excitability of fast-spiking neurons. In mouse models, neurons expressing this variant show reduced firing frequency. While these mice exhibit reduced body and brain weights similar to Kcnc1 knockout mice, other developmental milestones remain intact, suggesting specific effects on neuronal function rather than broad developmental abnormalities .

  • The S474C variant: This mutation disrupts normal anterograde trafficking of the channel from the endoplasmic reticulum (ER) to the Golgi apparatus. The variant protein shows reduced presence in the plasma membrane and is retained in the ER. In primary neuronal cultures, this leads to:

    • Reduced channel presence at the axon initial segment (AIS)

    • Broadened action potentials

    • Decreased neuronal firing frequency

    • Altered neuronal excitability that may contribute to epileptogenesis

These findings demonstrate that KCNC1 variants can cause neurological disorders through both trafficking defects and altered channel function, potentially offering different therapeutic targets based on the specific mechanism involved .

What experimental models are available for studying KCNC1-related disorders?

Several experimental models have been developed to study KCNC1-related disorders:

  • Transgenic mouse models:

    • Conditional expression models of pathogenic variants (e.g., Kcnc1-A421V) allow for temporal and spatial control of variant expression .

    • Knockout mouse models (Kcnc1-/-) have been used to study the effects of complete loss of KCNC1 function .

  • Primary neuronal culture systems:

    • Expression of mutant KCNC1 variants in primary neurons allows for detailed electrophysiological and trafficking studies .

    • These systems permit examination of subcellular localization, including analysis of channel distribution at the axon initial segment .

  • Computational models:

    • Conductance-based computational neuronal models have been used to predict the effects of KCNC1 variants on neuronal firing properties .

  • Expression systems:

    • Heterologous expression in cell lines (HEK293, CHO) for biochemical and electrophysiological characterization of channel variants .

These complementary approaches allow researchers to investigate the effects of KCNC1 variants at multiple levels, from molecular mechanisms to circuit function .

What methodologies are most effective for characterizing KCNC1 channel properties?

Several methodological approaches are particularly valuable for characterizing KCNC1 channel properties:

  • Electrophysiological assays:

    • Patch-clamp recordings in various configurations (whole-cell, cell-attached, inside-out) to assess:

      • Voltage-dependence of activation and inactivation

      • Kinetics of channel opening and closing

      • Single-channel conductance

      • Effects of mutations on channel gating properties

  • Trafficking and localization studies:

    • Immunocytochemistry with subcellular markers to determine localization patterns

    • Live-cell imaging with fluorescently tagged constructs to monitor trafficking dynamics

    • Biochemical fractionation to quantify surface expression versus internal pools

    • Pulse-chase experiments to assess protein turnover rates

  • Molecular interaction analyses:

    • Co-immunoprecipitation to identify interacting proteins

    • FRET/BRET approaches to characterize protein-protein interactions in living cells

    • Mass spectrometry to identify post-translational modifications and binding partners

  • Functional assessment in neuronal contexts:

    • Current-clamp recordings to determine effects on action potential waveform and firing frequency

    • Calcium imaging to assess downstream effects on neuronal signaling

    • Multi-electrode arrays to examine network-level consequences of channel dysfunction

These approaches should be combined for comprehensive characterization of normal and disease-associated KCNC1 variants.

How do KCNC1 channels interact with other potassium channel subunits and regulatory proteins?

KCNC1 exhibits complex interactions with other channel subunits and regulatory proteins:

  • Heteromeric assembly:

    • KCNC1 can form heteromultimeric channels with KCNC2 and potentially other subfamily members .

    • Heteromultimerization with KCNG3, KCNG4, and KCNV2 has been documented .

    • These heteromeric channels may have distinct biophysical properties and trafficking patterns compared to homomeric channels.

  • Regulatory interactions:

    • The C-terminal domain is critical for:

      • Channel modulation

      • Targeting to specific subcellular compartments

      • Interaction with scaffolding and regulatory proteins

    • Post-translational modifications (phosphorylation, SUMOylation, etc.) likely regulate channel function and localization.

  • Experimental approaches to study interactions:

    • Co-expression studies in heterologous systems

    • Immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID, APEX)

    • FRET/BRET-based interaction assays

Understanding these interactions is crucial for developing targeted therapies that might modulate specific channel complexes rather than affecting all KCNC1-containing channels .

What are the challenges in developing therapeutic approaches for KCNC1-related disorders?

Developing effective therapies for KCNC1-related disorders faces several challenges:

  • Mechanistic diversity:

    • Different mutations cause disease through distinct mechanisms (trafficking defects vs. altered gating) .

    • This necessitates mutation-specific therapeutic approaches rather than a one-size-fits-all strategy.

  • Neuronal specificity:

    • KCNC1 is expressed in specific neuronal populations, particularly fast-spiking interneurons .

    • Targeted delivery to these populations is challenging but necessary to avoid off-target effects.

  • Developmental considerations:

    • Many KCNC1-related disorders begin in infancy or early childhood .

    • Early intervention may be necessary before irreversible developmental alterations occur.

    • Mouse models show both developmental (reduced brain weight) and functional effects .

  • Therapeutic strategies under investigation:

    • Channel modulators to normalize gating properties

    • Trafficking enhancers for variants with folding/trafficking defects

    • Gene therapy approaches (gene replacement, antisense oligonucleotides)

    • Symptom-based approaches for seizure control

  • Current research initiatives:

    • The KCNC1 Foundation supports families and research efforts .

    • Funding initiatives like the Hartwell Foundation fellowship and grants from disease-specific foundations support innovative research approaches .

    • Recent advances in mouse models provide platforms for therapeutic testing .

Collaborative efforts between patient advocacy organizations like the KCNC1 Foundation and academic researchers are helping to address these challenges through targeted research initiatives and funding .

How should researchers design experiments to evaluate the effects of novel KCNC1 variants?

When evaluating novel KCNC1 variants, a comprehensive experimental approach should include:

  • Initial bioinformatic assessment:

    • Conservation analysis across species

    • Structural modeling to predict effects on protein folding and function

    • Comparison with known pathogenic and benign variants

  • In vitro functional characterization:

    • Expression in heterologous systems (HEK293, Xenopus oocytes)

    • Electrophysiological recordings to assess:

      • Voltage-dependent activation and inactivation

      • Channel kinetics

      • Current density

    • Trafficking studies to determine surface expression versus retention

    • Co-expression with wild-type KCNC1 to assess dominant-negative effects

  • Neuronal model systems:

    • Expression in primary neuronal cultures to assess:

      • Localization to the axon initial segment

      • Effects on action potential waveform

      • Changes in firing frequency and pattern

      • Synaptic transmission alterations

  • In vivo approaches:

    • Generation of knock-in mouse models

    • Assessments of:

      • Developmental milestones

      • Seizure susceptibility

      • Cognitive and behavioral phenotypes

      • Neuronal network activity through EEG recordings

This multi-level approach allows for comprehensive characterization of variant effects from molecular mechanisms to behavioral consequences.

What are the key considerations for studying KCNC1 trafficking and localization?

KCNC1 trafficking and localization studies require specific methodological considerations:

  • Subcellular compartment markers:

    • ER markers (calnexin, KDEL)

    • Golgi markers (GM130, TGN38)

    • Endosomal markers (Rab5, Rab7, Rab11)

    • Axon initial segment markers (AnkyrinG, βIV-spectrin)

  • Protein tagging strategies:

    • External epitope tags that don't disrupt trafficking

    • Position of tags to avoid interference with sorting signals

    • Fluorescent protein fusions with linkers to minimize functional disruption

    • Split-protein complementation for studying complex formation

  • Live-cell imaging approaches:

    • Photoactivatable or photoconvertible fluorescent proteins to track newly synthesized channels

    • FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

    • Super-resolution microscopy for detailed localization patterns

  • Biochemical approaches:

    • Cell surface biotinylation to quantify membrane expression

    • Glycosylation analysis to track progression through secretory pathway

    • Protease protection assays to determine membrane topology

The S474C variant provides an instructive example of trafficking defects, as it shows retention in the ER and reduced presence in the plasma membrane, particularly at the axon initial segment, demonstrating the importance of proper trafficking for neuronal function .

What control experiments are essential when studying recombinant KCNC1?

When working with recombinant KCNC1, the following controls are essential:

  • Expression controls:

    • Wild-type KCNC1 expressed under identical conditions

    • Empty vector controls to account for transfection effects

    • Housekeeping gene expression controls for normalization

  • Functional controls:

    • Known channel blockers (e.g., 4-aminopyridine, tetraethylammonium)

    • Varying external potassium concentrations to verify selectivity

    • Temperature controls for kinetic measurements

    • Internal controls for series resistance and cell capacitance in patch-clamp studies

  • Localization controls:

    • Co-expression with other Kv channel family members

    • Double labeling with compartment markers

    • Permeabilized versus non-permeabilized conditions to distinguish surface from internal pools

  • Experiment-specific controls:

    • For disease variants: Both wild-type and other variants with known functional consequences

    • For trafficking studies: Temperature-sensitive controls (e.g., expression at 30°C vs. 37°C)

    • For heteromeric channels: Expression of individual subunits alone versus co-expression

  • Cell type controls:

    • Expression in multiple cell types to account for cell-specific factors

    • Co-expression with cell-type specific interacting proteins

These controls help distinguish genuine effects of experimental manipulations from artifacts and provide appropriate reference points for interpreting results .

How should researchers analyze electrophysiological data from KCNC1 channels?

Electrophysiological data from KCNC1 channels requires specific analytical approaches:

  • Voltage-dependent activation:

    • Plot normalized conductance (G/Gmax) versus voltage

    • Fit with Boltzmann function to determine V₁/₂ (half-activation voltage) and slope factor

    • Compare parameters between wild-type and variant channels

  • Activation and deactivation kinetics:

    • Fit with exponential functions (single or double as appropriate)

    • Extract time constants at different voltages

    • Create voltage-dependent plots of time constants

  • Inactivation analysis:

    • Study steady-state inactivation with pre-pulse protocols

    • Determine recovery from inactivation time course

    • Analyze cumulative inactivation during repetitive stimulation

  • Action potential clamp:

    • Use recorded action potential waveforms as voltage commands

    • Analyze current contribution during different phases of the action potential

    • Perform at different firing frequencies to assess frequency-dependent effects

  • Statistical considerations:

    • Account for cell-to-cell variability

    • Use appropriate statistical tests for parametric or non-parametric data

    • Consider both biological and technical replicates

    • Report effect sizes along with p-values

When analyzing data from neurons expressing KCNC1 variants, researchers should focus on parameters most relevant to the high-frequency firing capabilities of the neurons, as this is a key physiological role of KCNC1 channels .

What approaches can resolve contradictory findings in KCNC1 research?

When faced with contradictory findings in KCNC1 research, consider these approaches:

  • Experimental system differences:

    • Expression system (HEK293 vs. neurons vs. Xenopus oocytes)

    • Recording conditions (temperature, solutions, recording mode)

    • Expression levels and stoichiometry of channel subunits

    • Presence of interacting proteins or regulatory factors

  • Methodological reconciliation:

    • Side-by-side comparison under identical conditions

    • Systematic variation of experimental parameters

    • Use of multiple complementary techniques

    • Independent verification by different laboratories

  • Model integration:

    • Computational modeling to test if seemingly contradictory results can be explained by a unified model

    • Consideration of state-dependent effects or complex kinetic schemes

    • Integration of in vitro and in vivo findings

  • Isoform-specific effects:

    • KCNC1 has multiple splice variants (the longer isoform has been called both "b" and "alpha," while the shorter isoform has been called both "a" and "beta")

    • Careful documentation of which isoform is being studied

    • Comparison of effects on different splice variants

For example, when studying KCNC1 variants, discrepancies between cellular studies and animal models might be reconciled by considering compensatory mechanisms present in vivo but absent in isolated cell systems .

How can researchers effectively translate findings from animal models to human KCNC1-related disorders?

Translating findings from animal models to human KCNC1-related disorders requires careful consideration of:

The transgenic mouse model expressing the Ala421Val variant provides valuable insights into KCNC1-related epilepsy, but researchers should note that while these mice show reduced body and brain weights, they don't display all the developmental abnormalities seen in human patients . These differences highlight the importance of complementary approaches when translating findings to human disease.

What emerging technologies could advance KCNC1 research?

Several emerging technologies hold promise for advancing KCNC1 research:

  • CRISPR-based approaches:

    • Precise genome editing to create isogenic cell lines with KCNC1 variants

    • Base editing for specific nucleotide changes without double-strand breaks

    • Prime editing for more complex edits with minimal off-target effects

    • CRISPRa/CRISPRi for modulating endogenous KCNC1 expression

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize channel distribution at nanoscale resolution

    • Expansion microscopy for improved spatial resolution of channel complexes

    • Voltage imaging with genetically encoded voltage indicators to correlate channel function with membrane potential changes

    • Cryo-electron microscopy for structural determination of KCNC1 channel complexes

  • Single-cell technologies:

    • Single-cell transcriptomics to identify cell-type specific expression patterns

    • Patch-seq to correlate electrophysiological properties with gene expression profiles

    • Spatial transcriptomics to map KCNC1 expression in intact tissue

  • Human model systems:

    • Patient-derived iPSCs differentiated into relevant neuronal subtypes

    • Brain organoids to study neurodevelopmental aspects of KCNC1 dysfunction

    • Microfluidic systems to model circuit-level effects of KCNC1 variants

These technologies will enable more precise understanding of how KCNC1 variants affect channel function, neuronal excitability, and circuit dynamics across development .

What are the unexplored aspects of KCNC1 function in normal physiology and disease?

Several aspects of KCNC1 function remain unexplored or incompletely understood:

  • Developmental roles:

    • Contribution to neuronal maturation and circuit formation

    • Temporal expression patterns during critical developmental windows

    • Interaction with neurodevelopmental signaling pathways

    • Role in activity-dependent developmental processes

  • Cell-type specific functions:

    • Differential roles in distinct neuronal populations

    • Contribution to specialized neuronal computations

    • Compensatory mechanisms in different cell types

    • Regional variations in channel properties

  • Regulatory mechanisms:

    • Post-translational modifications affecting channel function

    • Activity-dependent regulation of channel expression and localization

    • Role of non-coding RNAs in regulating KCNC1 expression

    • Epigenetic control of KCNC1 expression during development and disease

  • Network consequences:

    • Effects of KCNC1 dysfunction on circuit-level oscillations

    • Contribution to specific frequency bands of brain activity

    • Interaction with other channels in shaping network dynamics

    • Implications for cognition and behavior beyond seizures

  • Therapeutic opportunities:

    • Channel-specific modulators to normalize function of variant channels

    • Targeting trafficking pathways for variants with localization defects

    • Gene therapy approaches for haploinsufficiency

    • Network-level interventions to compensate for altered neuronal excitability

Future research addressing these gaps will provide a more comprehensive understanding of KCNC1's role in both normal physiology and disease states .

What are the optimal experimental conditions for studying KCNC1 channel function?

For optimal KCNC1 channel function studies, researchers should consider:

  • Expression systems:

    • Mammalian cell lines (HEK293, CHO) for basic biophysical characterization

    • Neuronal cell lines (Neuro2A, SH-SY5Y) for neuron-specific factors

    • Primary neurons for physiological context

    • Selection based on experimental goals and required sensitivity

  • Recording conditions:

    • Temperature: Near-physiological (33-37°C) for accurate kinetics

    • Solutions: Physiological ion concentrations; consider internal solution composition

    • Recording configuration: Whole-cell for macroscopic currents, outside-out patches for detailed kinetics

    • Series resistance compensation: Critical for accurate voltage control with large currents

  • Protocol design:

    • Holding potential: Usually -80 to -100 mV to ensure complete availability

    • Test pulse range: Typically -80 to +60 mV to cover full activation range

    • Pulse duration: 50-200 ms to capture activation and early inactivation

    • Inter-pulse intervals: Sufficient for complete recovery (typically ≥5 seconds)

    • Action potential protocols: For assessing contribution to neuronal firing

  • Analysis considerations:

    • Leak subtraction: P/4 or P/8 protocols from hyperpolarized potentials

    • Capacitance normalization: For comparing current density across cells

    • Junction potential correction: Typically 5-15 mV depending on solutions

    • Temperature correction for kinetic measurements if not at 37°C

By optimizing these conditions, researchers can obtain reproducible and physiologically relevant data on KCNC1 channel function .

How can researchers validate antibodies and tools for studying KCNC1?

Rigorous validation of antibodies and tools for KCNC1 research is essential:

  • Antibody validation strategies:

    • Knockout/knockdown controls: Test in KCNC1-null cells or tissues

    • Overexpression controls: Test in cells with defined KCNC1 expression

    • Multiple antibodies: Use antibodies targeting different epitopes

    • Peptide competition: Block with immunizing peptide

    • Cross-reactivity assessment: Test against related channels (KCNC2-4)

  • Tool validation approaches:

    • Expression constructs: Sequence verification and functional testing

    • siRNA/shRNA: Validation of knockdown efficiency and specificity

    • CRISPR reagents: Off-target analysis and validation of editing efficiency

    • Pharmacological tools: Specificity testing against related channels

  • Reproducibility considerations:

    • Detailed documentation of validation procedures

    • Lot-to-lot testing for antibodies

    • Sharing of validated resources with the research community

    • Publication of negative results from failed validation attempts

  • Application-specific validation:

    • For immunohistochemistry: Co-localization with known markers

    • For Western blotting: Expected molecular weight and band pattern

    • For immunoprecipitation: Mass spectrometry confirmation

    • For live-cell imaging: Control for effects on channel function

What collaborative approaches can accelerate KCNC1 research and therapeutic development?

Collaborative approaches to accelerate KCNC1 research include:

  • Multi-disciplinary research teams:

    • Integration of electrophysiologists, molecular biologists, and computational neuroscientists

    • Collaboration between basic scientists and clinicians

    • Partnerships between academic researchers and pharmaceutical companies

    • Involvement of patient advocacy organizations like the KCNC1 Foundation

  • Resource sharing:

    • Centralized repositories for validated reagents (antibodies, constructs, animal models)

    • Data sharing platforms for electrophysiological and imaging data

    • Open access to computational models and analysis tools

    • Patient registries and biobanks for clinical samples

  • Collaborative funding mechanisms:

    • Multi-investigator grants focusing on complementary approaches

    • Public-private partnerships for translational research

    • Initiatives like the Hartwell Foundation fellowship and the Penn Medicine Orphan Disease Center's Million Dollar Bike Ride campaign that provide targeted funding

    • International consortia to pool resources for rare disease research

  • Accelerated translation:

    • Parallel testing of therapeutic candidates in multiple model systems

    • Streamlined pipelines from target identification to clinical testing

    • Patient-centered outcome measures developed collaboratively with families

    • Regulatory engagement early in the therapeutic development process

The recent funding support for researchers working on potassium channel-related epilepsies demonstrates how collaborative approaches can catalyze research progress through targeted financial support and interdisciplinary collaboration .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.