Recombinant Human Potassium voltage-gated channel subfamily C member 2 (KCNC2)

Shipped with Ice Packs
In Stock

Description

Definition and Overview of Recombinant Human KCNC2

Recombinant Human Potassium voltage-gated channel subfamily C member 2 (KCNC2), also known as Kv3.2, is a lab-engineered protein that mimics the native voltage-dependent potassium channel subunit. It belongs to the Shaw subfamily and is primarily expressed in high-frequency firing neurons, such as GABAergic interneurons and retinal ganglion cells . The recombinant form is produced via heterologous expression systems (e.g., E. coli, mammalian cells, or cell-free systems) for research purposes, enabling precise studies of its structure, function, and pharmacological properties .

Protein Structure

KCNC2 is a transmembrane protein with six hydrophobic α-helical domains (S1–S6), forming a tetramer to create a potassium-selective pore. It often co-assembles with KCNC1 to form heterotetrameric channels, altering biophysical properties .

Functional Roles

  • Action Potential Repolarization: Mediates rapid repolarization of high-frequency action potentials in neurons, critical for sustained firing in inhibitory interneurons .

  • Neurological Regulation:

    • Maintains synaptic transmission fidelity by limiting calcium influx and GABA release .

    • Synchronizes gamma oscillations in the neocortex and modulates circadian rhythms in suprachiasmatic nucleus neurons .

Production Methods and Applications

Expression SystemPurityAdvantagesApplications
E. coli>90%High yield, cost-effectiveBasic electrophysiology studies
Cell-Free≥85%Native folding, post-translational modificationsStructural studies
Mammalian Cells>95%Proper folding, glycosylationFunctional assays (e.g., drug screening)

Key Applications:

  1. Electrophysiology: Characterizing channel activation/inactivation kinetics and modulation by ancillary subunits (e.g., KCNE1–3) .

  2. Drug Development: Screening blockers (e.g., tetraethylammonium [TEA], 4-aminopyridine [4-AP]) with IC₅₀ values of 0.1 mM .

  3. Disease Modeling: Studying mutations linked to developmental and epileptic encephalopathies .

Isoforms and Functional Diversity

KCNC2 exists in four isoforms (Kv3.2a–d), differing in C-terminal sequences . These variations influence:

  • Channel Localization: C-terminal interactions with scaffolding proteins.

  • Modulation: Responsiveness to phosphorylation (e.g., PKA/PKG pathways) .

Pharmacological Properties

AgentEffectMechanism
TEABlocks currents (IC₅₀ = 0.1 mM)Direct pore occlusion
4-APSimilar potency to TEAAlters channel gating kinetics
Nitric Oxide (NO)Slows activation/deactivationcGMP/PKG signaling cascade

Disease Associations and Research Implications

KCNC2 mutations are implicated in developmental and epileptic encephalopathy, particularly in high-frequency firing neurons . Recombinant KCNC2 enables:

  • Pathogenic Mutation Analysis: Assessing how mutations disrupt channel gating or trafficking.

  • Therapeutic Targeting: Identifying modulators to restore normal firing patterns in epileptic neurons .

Future Research Directions

  1. Circadian Rhythm Studies: Investigating KCNC2’s role in light-dependent SCN neuron firing .

  2. Synaptic Plasticity: Linking KCNC2-mediated repolarization to neurotransmitter release dynamics.

  3. Biotechnological Tools: Engineering KCNC2 variants for optogenetics or drug-delivery systems.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate your specific requirements. Please indicate your desired format in the order notes, and we will make every effort to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
In general, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCNC2; Potassium voltage-gated channel subfamily C member 2; Shaw-like potassium channel; Voltage-gated potassium channel Kv3.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-638
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNC2
Target Protein Sequence
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPP LSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRT GKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPG DDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFIL VSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFLVR IVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFK LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY SLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSVL SGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRS LNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL
Uniprot No.

Target Background

Function
The voltage-gated potassium channel, KCNC2, mediates transmembrane potassium transport in excitable membranes, primarily in the brain. It plays a crucial role in regulating fast action potential repolarization and sustained high-frequency firing in neurons of the central nervous system. Homotetrameric channels, formed by four KCNC2 subunits, conduct delayed-rectifier voltage-dependent potassium currents. These currents activate rapidly at high-threshold voltages and inactivate slowly. The channel facilitates potassium ion passage according to their electrochemical gradient, alternating between open and closed conformations in response to membrane voltage changes. KCNC2 can form functional homotetrameric and heterotetrameric channels with variable proportions of KCNC1 and potentially other family members, influencing channel properties based on the specific alpha subunit composition. Channel properties can also be modulated by association with ancillary subunits, such as KCNE1, KCNE2 or KCNE3, or indirectly by nitric oxide (NO) via a cGMP- and PKG-mediated signaling cascade, slowing channel activation and deactivation of delayed rectifier potassium channels. KCNC2 is involved in generating sustained trains of very brief action potentials at high frequency in retinal ganglion cells, thalamocortical and suprachiasmatic nucleus (SCN) neurons, and in hippocampal and neocortical interneurons. Sustained maximal action potential firing frequency in inhibitory hippocampal interneurons is negatively modulated by histamine H2 receptor activation in a cAMP- and protein kinase (PKA) phosphorylation-dependent manner. KCNC2 is essential for maintaining the fidelity of synaptic transmission in neocortical GABAergic interneurons by generating action potential (AP) repolarization at nerve terminals, thereby reducing spike-evoked calcium influx and GABA neurotransmitter release. It is also crucial for long-range synchronization of gamma oscillations across the neocortex. Furthermore, KCNC2 contributes to the modulation of the circadian rhythm of spontaneous action potential firing in SCN neurons in a light-dependent manner.
Gene References Into Functions
  1. These data suggest that reduced expression of KCNC2 is associated with altered hepatic gluconeogenesis and increased ER stress, potentially contributing to obesity-mediated diabetic risk. PMID: 27623749
  2. The distribution and levels of Kv3.2 were found to be similar in both normal and schizophrenia cases, and were not influenced by antipsychotic drugs, in any brain region tested. PMID: 23628987
  3. This complex phenotype is linked to a novel chromosomal deletion, suggesting potential roles for the genes KCNC2 and ATXN7L3B in human neurological disease. PMID: 23475819
  4. While all KV3 subunit transcripts are significantly expressed in whole brain extracts during embryonic development, only KV3.1, KV3.2, and KV3.4 subunit transgenic proteins are present. PMID: 21912965
Database Links

HGNC: 6234

OMIM: 176256

KEGG: hsa:3747

STRING: 9606.ENSP00000449253

UniGene: Hs.27214

Involvement In Disease
A chromosomal aberration involving KCNC2 has been found in a mother and her two children with varying degrees of neurodevelopmental delay and cerebellar ataxia. One child also exhibits episodes of unresponsiveness suggestive of absence seizures and facial dysmorphism. Deletion at 12q21.1 deletes exons 3-5 of KCNC2.
Protein Families
Potassium channel family, C (Shaw) (TC 1.A.1.2) subfamily, Kv3.2/KCNC2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Perikaryon. Cell projection, axon. Cell projection, dendrite. Cell junction, synapse, postsynaptic cell membrane. Cell junction, synapse, presynaptic cell membrane. Cell junction, synapse, synaptosome. Cell junction, synapse. Apical cell membrane. Basolateral cell membrane.

Q&A

What is KCNC2 and what is its primary function in neuronal physiology?

KCNC2 (also known as Kv3.2) is a member of the Shaw-related (Kv3) voltage-gated potassium channel subfamily that functions as an integral membrane protein mediating voltage-dependent potassium ion permeability of excitable membranes, primarily in the brain. The protein belongs to the delayed rectifier class of channel proteins and contributes critically to the regulation of fast action potential repolarization and sustained high-frequency firing in neurons of the central nervous system . Homotetramer channels formed by KCNC2 mediate delayed-rectifier voltage-dependent potassium currents that activate rapidly at high-threshold voltages and inactivate slowly, allowing for efficient neural signaling . This specific electrophysiological profile makes KCNC2 especially important for optimizing energy efficiency of action potentials in the brain while maintaining precise temporal coding of information in neural circuits .

Where is KCNC2 predominantly expressed in the human brain?

KCNC2 is predominantly expressed in the brain, with particularly high expression in specific regions including the interneurons of cortex, thalamus, hippocampus, and basal ganglia . Recent human single-cell transcriptome sequencing (scRNA-seq) studies have demonstrated that KCNC2 is enriched in both inhibitory and excitatory neurons . More specifically, high expression levels have been documented in the hippocampus, frontal cortex, anterior cingulate cortex, caudate, hypothalamus, basal amygdala, and pituitary . This regional distribution pattern provides important clues about the channel's role in regulating neuronal excitability and neural communication across different brain circuits.

How does KCNC2 contribute to neural network synchronization?

KCNC2 plays a critical role in neural synchronization, particularly for high-frequency oscillatory activity in the brain. The channel is required for long-range synchronization of gamma oscillations over distance in the neocortex . Additionally, it contributes to the modulation of circadian rhythm of spontaneous action potential firing in suprachiasmatic nucleus (SCN) neurons in a light-dependent manner . At the cellular level, KCNC2 is essential for subserving a fast-spiking firing pattern and sustaining trains of action potentials at high frequencies to maintain effective synaptic transmission and modulate neuronal excitation . This functional profile enables precise temporal coding in neural networks, which is essential for normal cognitive processing and sensory integration.

What expression systems are most effective for studying recombinant KCNC2 function?

For functional studies of recombinant KCNC2, the Xenopus laevis oocyte expression system has proven particularly effective and is commonly used in electrophysiological analysis of KCNC2 variants . This system allows for robust expression of the channel and detailed characterization of its biophysical properties. For mammalian expression, HEK293 cells and CHO cells provide good expression platforms. When selecting an expression system, researchers should consider:

  • The specific research question (biophysical properties vs. protein-protein interactions)

  • Required post-translational modifications

  • Compatibility with downstream assays (electrophysiology, imaging, biochemistry)

  • The need for neuronal-specific interacting proteins

For producing recombinant KCNC2 protein, yeast-derived expression systems with N-terminal tags (such as 6xHis) can be employed for purification purposes, similar to approaches used for other potassium channel proteins .

What electrophysiological protocols are most informative when studying KCNC2 channel function?

When investigating KCNC2 function through electrophysiological methods, several specific protocols yield particularly valuable information:

  • Voltage-activation protocols: Step protocols from holding potentials of -70 to -90 mV with depolarizing steps ranging from -80 to +60 mV are essential for determining activation kinetics and voltage dependence.

  • Tail current protocols: These are critical for accurate determination of the voltage dependence of activation.

  • Deactivation protocols: Given KCNC2's role in rapid repolarization, protocols examining channel closing at various repolarization potentials provide important functional insights.

  • Frequency-dependent recording: Since KCNC2 is involved in high-frequency firing, protocols that test channel behavior during repetitive stimulation at various frequencies (10-200 Hz) reveal its physiological functionality.

  • Pharmacological testing: Application of specific potassium channel blockers (TEA and 4-AP) at various concentrations helps confirm channel identity and characterize variant-specific pharmacology.

For KCNC2 variants, comparison of activation thresholds, deactivation kinetics, and response to repetitive stimulation between wild-type and mutant channels provides crucial information about potential pathogenic mechanisms .

What animal models exist for studying KCNC2 function in vivo?

Several animal models have been developed to study KCNC2 function in vivo, although they are less extensively characterized than models for some other potassium channels. The most informative models include:

  • Kcnc2 knockout mice: These models have demonstrated the importance of KCNC2 in maintaining normal neuronal excitability and network function .

  • Knockin models of specific variants: Generated using CRISPR/Cas9 technology, these models carrying specific human variants provide valuable insights into the pathophysiological mechanisms of KCNC2-related disorders.

  • Conditional and neuron-specific knockout models: These allow for more precise spatial and temporal control of KCNC2 deletion, helping to dissect its role in specific neural circuits and developmental periods.

When using these models, researchers should assess multiple parameters including:

  • Electrophysiological properties (in vitro and in vivo)

  • Seizure susceptibility (using pentylenetetrazol or other proconvulsants)

  • Cognitive and behavioral phenotyping

  • Network activity (EEG recordings)

  • Compensatory changes in other ion channels

What spectrum of neurological disorders is associated with KCNC2 variants?

KCNC2 variants have been implicated in a broad spectrum of neurological disorders, primarily epilepsy syndromes with varying severity. Specific phenotypes include:

  • Developmental and epileptic encephalopathies (DEEs), including early-onset absence epilepsy (EOAE)

  • Genetic generalized epilepsy (GGE)

  • Focal epilepsy (FE)

  • Myoclonic-atonic epilepsy (MAE)

Beyond epilepsy, KCNC2 has been proposed as a modifying factor in other neuropsychiatric conditions including ataxia, schizophrenia, bipolar disorder, and autism spectrum disorder . Patients with KCNC2 variants frequently display additional neurological features including facial dysmorphism, ataxia, speech disturbance, depression, hyperactivity, and intellectual disability (ID) .

How do gain-of-function versus loss-of-function KCNC2 variants affect clinical phenotypes?

The relationship between KCNC2 channel dysfunction and clinical phenotype demonstrates a complex genotype-phenotype correlation:

  • Gain-of-function variants: These are predominantly associated with more severe phenotypes such as developmental and epileptic encephalopathies (DEEs) and early-onset absence epilepsy (EOAE). Examples include the R405G variant, which yields higher activity in vitro than wild-type KCNC2 across a range of functioning voltages . Other gain-of-function variants associated with severe phenotypes include V471L, R351K, T437A, and T437N .

  • Loss-of-function variants: These tend to be associated with milder phenotypes such as genetic generalized epilepsy (GGE) . Functional analysis has demonstrated dramatic loss-of-function effects in GGE-associated variants .

This functional dichotomy suggests that precise regulation of KCNC2 activity is critical for normal brain function, with both increased and decreased channel function capable of disrupting neuronal excitability and network dynamics, albeit with different clinical manifestations. Understanding these functional consequences is essential for developing targeted therapeutic approaches.

What approaches are most effective for functional characterization of KCNC2 variants?

Comprehensive functional characterization of KCNC2 variants requires a multi-modal approach:

  • Electrophysiological analysis:

    • Patch-clamp recordings in heterologous expression systems (HEK293 cells or Xenopus oocytes)

    • Analysis of key parameters: activation/deactivation kinetics, voltage dependence, and current density

    • Assessment of channel behavior during high-frequency stimulation

  • Cellular trafficking and expression studies:

    • Immunocytochemistry to assess subcellular localization

    • Surface biotinylation assays to quantify membrane expression

    • Western blotting to evaluate total protein expression levels

  • Neuronal modeling:

    • Implementation of variant-specific changes in computational models of neurons

    • Prediction of effects on action potential waveform and firing patterns

  • Patient-derived models:

    • iPSC-derived neurons from affected individuals

    • CRISPR/Cas9 engineering of variants in control iPSC lines

For the most comprehensive assessment, researchers should examine both biophysical channel properties and the impact on neuronal excitability in relevant cellular contexts, with particular attention to high-frequency firing capability, which is a hallmark function of KCNC2 channels .

How do KCNC2 channels interact with other proteins in the neuronal membrane?

KCNC2 channels interact with various proteins that modulate their function, localization, and integration into neuronal signaling complexes:

  • Auxiliary subunits: KCNC2 can form functional homotetrameric channels but also heterotetrameric channels containing variable proportions of KCNC1 and possibly other family members. These associations significantly influence channel properties .

  • Regulatory proteins: Channel properties may be modulated by association with ancillary subunits such as KCNE1, KCNE2, or KCNE3 .

  • Signaling pathways: KCNC2 can be indirectly modulated by nitric oxide (NO) through a cGMP- and PKG-mediated signaling cascade, which slows channel activation and deactivation .

  • Scaffolding proteins: While not explicitly detailed in the provided sources, KCNC2 likely interacts with PDZ domain-containing scaffolding proteins that facilitate its proper localization in specific neuronal compartments.

Understanding these interactions is critical for developing targeted interventions that might modulate channel function in pathological conditions. Future research should focus on identifying the complete interactome of KCNC2 in different neuronal populations and determining how disease-associated variants affect these protein-protein interactions.

What are the most promising therapeutic approaches for KCNC2-related disorders?

Based on current understanding, several therapeutic approaches show promise for KCNC2-related disorders:

  • Conventional antiepileptic drugs (AEDs): Valproic acid has shown efficacy in some KCNC2-related epilepsies. Eight drug-responsive patients became seizure-free using valproic acid as monotherapy or in combination, including severe DEE cases .

  • Channel-specific modulators: Development of compounds that can selectively modulate KCNC2 function, either enhancing activity (for loss-of-function variants) or reducing activity (for gain-of-function variants).

  • Precision medicine approaches: Similar to treatments developed for other potassium channelopathies, such as the use of 4-aminopyridine in KCNA2-related DEEs .

  • Gene therapy: Approaches targeting either supplementation of functional KCNC2 (for loss-of-function) or suppression of mutant alleles (for dominant negative or gain-of-function).

The optimal therapeutic strategy likely depends on the specific functional consequence of the variant (gain vs. loss of function), highlighting the importance of thorough functional characterization. Future research should focus on developing variant-specific treatment algorithms based on channel biophysics and cellular phenotypes.

What novel technologies are advancing KCNC2 research?

Several cutting-edge technologies are transforming KCNC2 research and offer promising avenues for future investigation:

  • High-throughput electrophysiology platforms: Automated patch-clamp systems enable rapid functional characterization of multiple KCNC2 variants and potential therapeutic compounds.

  • Cryo-electron microscopy (Cryo-EM): This technique can provide detailed structural insights into KCNC2 channel architecture and how disease-associated variants affect channel conformation.

  • Single-cell transcriptomics: These approaches have already revealed that KCNC2 is enriched in both inhibitory and excitatory neurons , and further application can identify cell type-specific expression patterns and co-expression networks.

  • Human brain organoids: These 3D cultures derived from patient iPSCs provide opportunities to study KCNC2 function in complex human neural networks with relevant cellular architecture.

  • In vivo neurophysiology: Advanced techniques for recording and manipulating neuronal activity in awake, behaving animals allow for unprecedented insights into how KCNC2 dysfunction affects circuit dynamics.

  • Computational modeling: Integration of structural, biophysical, and network data into detailed computational models can predict the impact of KCNC2 variants on neuronal and circuit function.

These technologies, when used in combination, have the potential to significantly advance our understanding of KCNC2 biology and pathology, ultimately leading to more effective therapeutic strategies for KCNC2-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.