Recombinant Human Potassium voltage-gated channel subfamily D member 1 (KCND1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
Kcnd1; KCND1_HUMAN; Kv4.1; mShal; OTTHUMP00000025805; OTTHUMP00000025806; Potassium voltage gated channel Shal related subfamily member 1; Potassium voltage gated channel subfamily D member 1; Potassium voltage-gated channel subfamily D member 1; Shal type potassium channel; Voltage gated potassium channel Kv4.1; Voltage gated potassium channel subunit Kv4.1; Voltage-gated potassium channel subunit Kv4.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-647
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCND1
Target Protein Sequence
MAAGLATWLPFARAAAVGWLPLAQQPLPPAPGVKASRGDEVLVVNVSGRRFETWKNTLDR YPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGDGPALPAGSSLRQRLWRAFENPH TSTAALVFYYVTGFFIAVSVIANVVETIPCRGSARRSSREQPCGERFPQAFFCMDTACVL IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLLVPKNDDVSGAFVTLRVFRVF RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTNKTNFTSIP AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHH LLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRR AIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIIS IPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL
Uniprot No.

Target Background

Function
This protein represents the pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. It may contribute to I(To) current in the heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.
Gene References Into Functions
  1. S-glutathionylation of an auxiliary subunit confers redox sensitivity to Kv4 channel inactivation. PMID: 24675763
  2. Immunoblotting data revealed higher expression levels of KV4.1 receptors in patients with cortical dysplasia and intractable epilepsy. PMID: 25003238
  3. Research findings indicate that Kv4.1 plays a role in the proliferation of tumorigenic human mammary epithelial cells. PMID: 19401188
Database Links

HGNC: 6237

OMIM: 300281

KEGG: hsa:3750

STRING: 9606.ENSP00000218176

UniGene: Hs.55276

Protein Families
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.1/KCND1 sub-subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, dendrite.
Tissue Specificity
Widely expressed. Highly expressed in brain, in particular in cerebellum and thalamus; detected at lower levels in the other parts of the brain.

Q&A

What is the basic structure of the KCND1-encoded Kv4.1 channel?

Kv4.1 channels, encoded by KCND1, follow the typical voltage-gated potassium channel architecture. The α-subunit consists of six transmembrane segments (S1-S6) flanked by cytoplasmic termini. Between S5 and S6 lies a re-entrant pore loop containing the highly conserved potassium channel "signature sequence" responsible for ion selectivity. The cytoplasmic N-terminus contains a tetramerization (T1) domain that mediates subfamily-specific assembly, with specific Zn²⁺ coordination sites contributing to this process. Within a tetramer, S5 and S6 surround the central ion conduction pathway, with the distal S6 segments acting as the cytoplasmic gate, while S1-S4 segments (particularly the positively charged residues in S4) function as voltage sensors .

What are the primary physiological roles of Kv4.1 channels in neurons?

Kv4.1 channels, along with other Kv4 subfamily members, mediate a subthreshold-activating, somatodendritic, rapidly activating and inactivating (A-type) potassium current (I_SA) in neurons. This current plays critical roles in neurophysiology, including control of low frequency repetitive discharge, regulation of dendritic excitation, action potential backpropagation, and synaptic plasticity. The specific contribution of Kv4.1 compared to other Kv4 family members (Kv4.2 and Kv4.3) varies by brain region and neuronal type .

How do auxiliary subunits modify Kv4.1 channel function?

Kv4.1 channels form complexes with two types of auxiliary β subunits: cytosolic Kv channel interacting proteins (KChIPs) and transmembrane dipeptidyl aminopeptidase-like proteins (DPPs). Both KChIPs and DPPs increase Kv4 channel surface expression and modulate channel gating in subunit-specific ways. The cytoplasmic N-terminus (including the T1-domain) and C-terminus of Kv4.1 interact with KChIPs, while transmembrane segments S1 and S2 are involved in DPP binding. Native Kv4 channels likely assemble in a ternary complex with both types of auxiliary β subunits. Since the interaction sites for KChIPs and DPPs on Kv4.1 do not overlap, their effects on channel function are generally additive .

What expression systems are recommended for functional studies of recombinant KCND1?

For functional characterization of Kv4.1 channels, Xenopus laevis oocytes provide an excellent expression system due to their large size, ease of manipulation, and low endogenous channel expression. To study human KCND1, researchers should clone the full-length human KCND1 cDNA (GenBank: NM_004979.6) into appropriate expression vectors with optimized Kozak sequences (e.g., pGEM-HE). For voltage-clamp recordings, inject 5 ng total cRNA per oocyte to generate Kv4.1 homotetramers. When investigating interactions with auxiliary subunits, co-inject Kv4.1 with KChIP (e.g., KChIP2b) and/or DPP (e.g., DPP6s) cRNAs in appropriate ratios (e.g., 5+5 ng for binary complexes or 2+5+5 ng for ternary complexes) .

What are the optimal electrophysiological protocols for characterizing Kv4.1 channel properties?

For electrophysiological recordings of Kv4.1 channels, two-electrode voltage clamp at room temperature (20-22°C) is recommended when using Xenopus oocytes. Use a low chloride (15 mM) bath solution containing (in mM): 7.4 NaCl, 88.6 Na-aspartate, 2 KCl, 1.8 CaCl₂, 1 MgCl₂, and 5 HEPES, pH 7.4 with NaOH. To characterize channel kinetics, analyze current decay with double-exponential functions and recovery from inactivation with single-exponential functions. For voltage dependence studies, apply appropriate Boltzmann functions to analyze activation and steady-state inactivation. Statistical analyses should employ ANOVA with Dunnett's post hoc testing for multiple group comparisons and Student's t-tests for two-group comparisons .

How should researchers introduce and validate KCND1 variants for functional studies?

To study KCND1 variants, use site-directed mutagenesis methods (such as the Quick-Change II kit) to introduce specific mutations into the wild-type KCND1 expression construct. Always verify the introduced mutations by Sanger sequencing. For functional characterization, express both wild-type and variant channels under identical conditions and compare their biophysical properties. Key parameters to analyze include current density, activation/inactivation voltage dependence, gating kinetics, and recovery from inactivation. To assess potential pathogenicity, determine if variants alter interactions with auxiliary subunits by testing channel function in the presence of KChIPs and/or DPPs. This approach is critical as native Kv4 channels typically function as multiprotein complexes .

What is the clinical presentation associated with pathogenic KCND1 variants?

Hemizygous KCND1 variants have been associated with an X-linked neurodevelopmental disorder in male individuals. The clinical phenotype is characterized by diverse neurological abnormalities, primarily including delays in various developmental domains, distinct neuropsychiatric signs, and seizures. The severity and specific manifestations show variable expressivity across affected individuals. Significantly, heterozygous carrier mothers typically remain clinically unaffected, consistent with X-linked inheritance. This phenotypic spectrum resembles that observed with variants in KCND2 (encoding Kv4.2), which have been linked to early-onset global developmental delay, often with seizures, muscular hypotonia, and/or visual impairment .

What types of KCND1 variants have been associated with neurodevelopmental disorders?

A cohort study identified 17 distinct hemizygous KCND1 variants across 18 male individuals from 17 families. These included:

  • Two de novo missense variants (p.Arg92Cys and p.Asp115Asn)

  • Three maternally inherited protein-truncating variants (one frameshift and two nonsense mutations)

  • Twelve maternally inherited missense variants

Most variant-associated amino acid substitutions affect either the cytoplasmic N- or C-terminus of the channel protein, with only two occurring in transmembrane segments (S1 and S4). The table below summarizes key characteristics of selected variants:

Variant TypeProtein ChangeConservationREVEL ScoreCADD ScoreAlpha-MissensePolyPhen-2
De novo missensep.Arg92CysConserved0.40424.701.0
De novo missensep.Asp115AsnConserved0.16523.60.0370.388
Truncatingp.Tyr61Cysfs*31ConservedN/AN/AN/AN/A
Truncatingp.Arg99*ConservedN/A35N/AN/A
Missensep.Thr516SerVariable0.15715.870.1020.044
Missensep.Arg536GlyConserved0.82225.10.1940.949
Missensep.Asn578IleConserved0.81426.90.7561.0

How do pathogenic variants alter the biophysical properties of Kv4.1 channels?

Pathogenic KCND1 variants can affect Kv4.1 channel function through diverse mechanisms, resulting in variable alterations to biophysical properties. These may include:

  • Changes in current density due to altered channel trafficking or expression

  • Shifts in voltage-dependent activation or inactivation

  • Modified gating kinetics (activation, inactivation, and recovery from inactivation)

  • Altered channel conductance or ion selectivity

  • Disrupted interactions with auxiliary subunits

The specific effects are variant-dependent and may vary in magnitude. Protein-truncating variants typically cause loss of function, while missense variants may produce more subtle alterations in channel properties. Importantly, the functional consequences of variants should be evaluated both in the absence and presence of auxiliary subunits (KChIPs and DPPs), as these interactions are critical for normal channel function in vivo .

What are the key considerations when interpreting electrophysiological data from KCND1 variant studies?

When interpreting electrophysiological data from KCND1 variant studies, consider several important factors. First, compare multiple biophysical parameters rather than focusing on a single property, as pathogenic effects may manifest through various mechanisms. Second, evaluate channel function both with and without auxiliary subunits, as variants might specifically disrupt these interactions. Third, consider the physiological context—even seemingly small changes in channel kinetics can significantly impact neuronal excitability in vivo. Fourth, correlate functional alterations with clinical severity when possible. Finally, recognize that in vitro systems may not fully recapitulate the native neuronal environment, and complementary approaches (such as computational modeling or studies in neuronal cultures) may be necessary to fully understand pathophysiological implications .

How do KCND1 interactions with auxiliary subunits affect experimental design and interpretation?

When designing experiments to study KCND1, researchers must account for interactions with auxiliary subunits, as these profoundly impact channel properties. Native Kv4.1 channels typically function as multiprotein complexes with KChIPs and/or DPPs, which modify surface expression, voltage dependence, and gating kinetics. Therefore, experimental designs should include conditions with the channel alone and in combination with relevant auxiliary subunits (binary and ternary complexes). For complete characterization, researchers should test if variants affect the binding affinity or functional modulation by these subunits. The cytoplasmic N-terminus (including the T1-domain) and C-terminus interact with KChIPs, while S1 and S2 transmembrane segments bind DPPs. Consequently, variants in these regions may specifically disrupt interactions with particular auxiliary subunits rather than altering intrinsic channel properties .

What are the considerations for studying the tissue-specific effects of KCND1 variants?

KCND1 is expressed in various tissues, including brain regions and cardiac tissue, with potential tissue-specific functions and interactions. When investigating tissue-specific effects of KCND1 variants, researchers should consider several factors. First, characterize the expression profile of KCND1 and its splicing isoforms across relevant tissues. Second, identify tissue-specific auxiliary subunits that interact with Kv4.1 channels, as these may modulate variant effects. Third, account for compensatory mechanisms in different tissues, such as upregulation of other Kv4 family members. Fourth, consider the cellular context, including cell-type specific signaling pathways that might modulate channel function. Finally, develop appropriate model systems that recapitulate tissue-specific environments, potentially including patient-derived induced pluripotent stem cells differentiated into relevant cell types .

What is the role of Long non-coding RNA KCND1 (LncKCND1) in cardiac function?

Beyond its role as a protein-coding gene for voltage-gated potassium channels, research has identified a long non-coding RNA associated with KCND1 (LncKCND1) that plays a protective role in cardiac function. LncKCND1 is downregulated in both transverse aortic constriction (TAC)-induced hypertrophic mouse hearts and Angiotensin II (Ang II)-induced neonatal mouse cardiomyocytes. Experimental manipulation of LncKCND1 expression has demonstrated its functional significance: knockdown impairs cardiac mitochondrial function and leads to hypertrophic changes in cardiomyocytes, while overexpression inhibits Ang II-induced cardiomyocyte hypertrophic changes. Significantly, enhanced expression of LncKCND1 protects the heart from TAC-induced pathological cardiac hypertrophy and improves heart function in TAC mice. Mechanistically, LncKCND1 acts by directly binding to Y-box binding protein 1 (YBX1) and regulating its expression. This research highlights an additional dimension of KCND1 biology beyond its protein-coding function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.