Recombinant Human Potassium voltage-gated channel subfamily D member 2 (KCND2)

Shipped with Ice Packs
In Stock

Description

Biological Functions

KCND2 channels are essential for:

  • Neuronal regulation: Mediates dendritic A-type currents (I<sub>SA</sub>), controlling action potential back-propagation and firing frequency .

  • Cardiac function: Contributes to the transient outward current (I<sub>to</sub>) in rodent hearts, though not in humans .

  • Circadian rhythm: Modulates suprachiasmatic nucleus activity to regulate locomotor rhythms .

Pathophysiological Roles

KCND2 is implicated in multiple diseases:

DiseaseMechanismEvidence
EpilepsyDownregulation by miR-324-5p increases neuronal excitability, triggering seizures
ArrhythmiasAltered I<sub>to</sub> currents linked to cardiac repolarization defects
HypertensionDysregulation in vascular smooth muscle contraction

Pharmacological Interactions

KCND2 is modulated by various drugs:

DrugActionDetailsSource
ImipramineInhibitorBlocks channel activity
DalfampridineAntagonistReduces channel function
EnfluraneDual inhibitor/activatorAnesthetic effects

Research Applications

Recombinant KCND2 is used in:

  • Electrophysiology: Patch-clamp studies to assess channel gating kinetics.

  • Drug discovery: High-throughput screening for modulators of neuronal excitability or cardiac arrhythmias.

  • Protein interaction studies: Co-immunoprecipitation assays to identify binding partners (e.g., FLNC, KCNIP subunits) .

Key Research Findings

  1. miRNA Regulation: miR-324-5p suppresses KCND2 expression, exacerbating seizure susceptibility .

  2. Accessory Protein Modulation: KCNIP2 and DPP6 enhance KCND2 surface expression and slow inactivation kinetics .

  3. Species-Specific Differences: Rodent vs. human I<sub>to</sub> currents highlight translational challenges in cardiac studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate your needs in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCD2; KCND 2; KCND2; KCND2_HUMAN; KIAA1044; MGC119702; MGC119703; Potassium voltage gated channel Shal related subfamily member 2; Potassium voltage-gated channel subfamily D member 2; RK 5; RK5; Voltage gated potassium channel Kv4.2; Voltage gated potassium channel subunit Kv4.2; Voltage sensitive potassium channel; Voltage-gated potassium channel subunit Kv4.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-630
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCND2
Target Protein Sequence
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDTAGESALPTMTARQRVWRAFENPHT STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHH LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRI PNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI PTPPVTTPEGDDRPESPEYSGGNIVRVSAL
Uniprot No.

Target Background

Function
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain. It mediates the major part of the dendritic A-type current I(SA) in brain neurons. This current is activated at membrane potentials that are below the threshold for action potentials. It regulates neuronal excitability, prolongs the latency before the first spike in a series of action potentials, regulates the frequency of repetitive action potential firing, shortens the duration of action potentials and regulates the back-propagation of action potentials from the neuronal cell body to the dendrites. It contributes to the regulation of the circadian rhythm of action potential firing in suprachiasmatic nucleus neurons, which regulates the circadian rhythm of locomotor activity. It functions downstream of the metabotropic glutamate receptor GRM5 and plays a role in neuronal excitability and in nociception mediated by activation of GRM5. It mediates the transient outward current I(to) in rodent heart left ventricle apex cells, but not in human heart, where this current is mediated by another family member. It forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. It can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCND2 and KCND3; channel properties depend on the type of pore-forming alpha subunits that are part of the channel. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes. Interaction with specific isoforms of the regulatory subunits KCNIP1, KCNIP2, KCNIP3 or KCNIP4 strongly increases expression at the cell surface and thereby increases channel activity; it modulates the kinetics of channel activation and inactivation, shifts the threshold for channel activation to more negative voltage values, shifts the threshold for inactivation to less negative voltages and accelerates recovery after inactivation. Likewise, interaction with DPP6 or DPP10 promotes expression at the cell membrane and regulates both channel characteristics and activity.
Gene References Into Functions
  1. A mutation, V404M, in the Kv4.2 channel subunit is associated with infant-onset epilepsy and autism. V404M enhances inactivation of channels that have not opened but dramatically impairs inactivation after opening. Authors show that increased side-chain volume is largely responsible for these seemingly paradoxical effects. PMID: 29581270
  2. Our results do not support the notion that accessory KChIP2 binding is a prerequisite for dendritic trafficking and functional surface expression of Kv4.2 channels, however, accessory KChIP2 binding may play a potential role in Kv4.2 modulation during intrinsic plasticity processes. PMID: 29385176
  3. Ca(2+)/calcineurin (CaN)/nuclear factor of activated T-cells (NFAT) c4 axis is required for neuritin-induced Kv4.2 transcriptional expression and potentiation of IA densities in cerebellum granule neurons. PMID: 27307045
  4. closed-state inactivation in Kv4.2 channels is a multistep process PMID: 26745419
  5. The study provides the first piece of evidence for the role of H2S in regulating Ito potassium channels and also the specific motif in an ion channel labile for H2S regulation. PMID: 25756524
  6. The stoichiometry of the Kv4.2-DPP10 complex was variable depending on the relative expression level of each subunit, with a preference for 4:2 stoichiometry PMID: 26209633
  7. The findings of this study suggest that variations in KCND2 genes are associated with both mild and severe persistent breast pain after breast cancer surgery. PMID: 25599232
  8. A rare genetic mutation of the KCND2 gene, p.D612N, was identified in a single patient. Co-expression of mutant and wild-type KCND2 with KChIP2 demonstrated a gain-of-function phenotype. PMID: 25214526
  9. study identified a de novo variant p.Val404Met in KCND2 in a family with identical twins affected with autism and severe seizures; findings suggest KCND2 is the causal gene for epilepsy in this family and has a role in the etiology of autism PMID: 24501278
  10. Subunit counting by single-molecule imaging revealed that the bound number of KChIP4 in each Kv4.2.KChIP4 complex was dependent on the expression level of KChIP4. PMID: 24811166
  11. reflected in the immunoblotting data KV4.2 receptors were detected at higher levels of expression in patient with cortical dysplasia with intractable epilepsy. PMID: 25003238
  12. KCND2 is expressed in human skin, but has not been associated with aging. PMID: 24037343
  13. WT PrP(C), in a DPP6-dependent manner, modulated Kv4.2 channel properties, causing an increase in peak amplitude PMID: 24225951
  14. Our results support the hypothesis that KChIPs enhances Kv4.2 functional expression by a 1 : 1 suppression of the N-terminal FERN domain and by producing additional positive regulatory effects on functional channel expression. PMID: 23692269
  15. Autoantibodies from patients with encephalitis are specific for DPPX (a subunit of Kv4.2) without reacting to Kv4.2. PMID: 23225603
  16. Seizures in Kv4.2 transgenic mice rapidly redistribute K+ channel subunit Kv4.2 to the neuronal surface, implicating a molecular substrate for the increased K+ current. PMID: 22122031
  17. KChIP2 differentially regulates total and cell surface Kv4.2 protein expression and Kv4 current densities. PMID: 20709747
  18. MiRP3 modulates Kv4.2 current activation, inactivation and recovery from inactivation. MiRP3 shifts the half-maximal voltage for activation and slows time to peak ~ 100%. PMID: 20498229
  19. PSD-95 increased the amount of Kv1.4, but not Kv4.2, in lipid rafts. PMID: 14559911
  20. Kv4.2 and K+ channel-interacting protein 2 make up a complex of Ito channels PMID: 14623880
  21. Data show that KChIP1, KChIP2.1, and KChIP2.2 could form homo- as well as hetero-oligomers, and that this oligomerization did not perturb their interaction with Kv4.2 potassium channel. PMID: 15358149
  22. mutations in KCND2 and KCND3 are not a frequent cause of long QT syndrome PMID: 15563876
  23. Data show that the Kv4.2 voltage-dependent potassium channel acts as a fast-responding steroid sensor in human granulosa cells. PMID: 15991246
  24. Traffic of Kv4.2 is coat protein complex I (COPI)-dependent. PMID: 16260497
  25. the C-terminal domain of Kv4.2 plays a critical role in voltage-dependent activation and functional expression that is mediated by direct interaction between the Kv4.2 C terminus and KChIP2 PMID: 16820361
  26. Electrophysiological analysis indicates attenuated K+ current density in cells expressing this Kv4.2-N587fsX1 mutant channel, which is consistent with a model of aberrant neuronal excitability characteristic of TLE. PMID: 16934482
  27. two Ca2+-dependent posttranslational events regulate the activity of DREAM on Kv4.2 channel function PMID: 17102134
  28. Our results further suggest distinct mechanisms for Kv4.2 gating modulation by KChIPs and DPPs. PMID: 17981906
  29. biophysical and biochemical methods indicate that I(SA) channels carry four subunits each of Kv4.2 and DPP6. PMID: 18364354
  30. rodent and human Abeta are effective in modulating K currents PMID: 18463498
  31. An ALA-scanning mutagenesis in the S4-S5 linker region, the initial part of S5, and the distal part of S6, in X. laevis oocytes showed that temporary uncoupling at the interface between V sensor and cytoplasmic gate may underlie closed-state inactivation. PMID: 19171772
  32. SAP97 is a major partner for surface expression and CaMKII-dependent regulation of cardiac Kv4.2 and kv4.3 channels. PMID: 19213956
  33. the inhibition of maximal amplitude of Kv4.2 channels by arachidonic acid can explain the inhibition of somatodendritic I(A) in hippocampal neurons PMID: 19453640
  34. This study indicated that Kv4.2 is expressed in both neuronal and glial cells and its regulation may involve potassium channel interacting proteins, alterations in the subcellular localization of the channel. PMID: 19596445

Show More

Hide All

Database Links

HGNC: 6238

OMIM: 605410

KEGG: hsa:3751

STRING: 9606.ENSP00000333496

UniGene: Hs.654739

Involvement In Disease
KNCD2 mutations have been found in a family with autism and epilepsy and may play a role in disease pathogenesis. Autism is a complex multifactorial, pervasive developmental disorder characterized by impairments in reciprocal social interaction and communication, restricted and stereotyped patterns of interests and activities, and the presence of developmental abnormalities by 3 years of age. Epilepsy is characterized by paroxysmal transient disturbances of the electrical activity of the brain that may be manifested as episodic impairment or loss of consciousness, abnormal motor phenomena, psychic or sensory disturbances, or perturbation of the autonomic nervous system.
Protein Families
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.2/KCND2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell junction, synapse. Perikaryon. Cell junction, synapse, postsynaptic cell membrane. Cell projection, dendritic spine. Cell junction.
Tissue Specificity
Detected in ovary, in corpus luteum and in granulosa and theca cells in the follicle (at protein level). Highly expressed throughout the brain. Detected in amygdala, caudate nucleus, cerebellum, hippocampus, substantia nigra and thalamus. Expression is no

Q&A

What is KCND2 and what is its primary function in human physiology?

KCND2 encodes the pore-forming (α) subunit of the Kv4.2 potassium channel, which belongs to the voltage-gated potassium channel family. These channels represent one of the most complex classes of voltage-gated ion channels from both functional and structural perspectives. KCND2/Kv4.2 mediates a rapidly inactivating, A-type outward potassium current and plays a critical role in the repolarization phase of the action potential. The diverse functions of this channel include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume .

How does KCND2 contribute to cardiac electrophysiology?

In cardiac physiology, KCND2 (Kv4.2) works alongside Kv4.3 to contribute to the cardiac fast transient outward K+ current (Ito). This current underlies the early phase of repolarization in the cardiac action potential, thereby setting the initial potential of the plateau phase and governing its duration and amplitude. Through this mechanism, KCND2 plays a crucial role in cardiac rhythm maintenance. Alterations in KCND2 function can lead to cardiac arrhythmias, as evidenced by gain-of-function mutations causing atrial fibrillation .

What regulatory mechanisms control KCND2 channel function?

KCND2 channel function is regulated by multiple mechanisms, with protein kinase C (PKC) phosphorylation being particularly significant. The channel contains phosphorylation sites, including Ser447, which allows attenuation of Kv4.2 membrane expression when phosphorylated. This regulatory pathway is mediated by α-adrenergic receptor stimulation in physiological conditions. When this phosphorylation is impaired, as observed with the p.S447R mutation, there is increased membrane expression of Kv4.2, which enhances potassium currents .

What expression systems are optimal for studying KCND2 channel properties?

For functional characterization of KCND2 channels, Xenopus laevis oocytes represent an established and reliable expression system. This approach allows for the use of the 2-electrode voltage-clamp technique to study channel activity. When investigating KCND2, it is crucial to co-express auxiliary proteins such as KChIP2 (Kv channel–interacting protein 2), as these interactions significantly modulate channel properties in vivo. This experimental setup enables accurate assessment of channel kinetics, including activation, inactivation, and recovery from inactivation parameters .

What electrophysiological protocols are recommended for characterizing KCND2 mutations?

To thoroughly characterize KCND2 channel properties and mutations, researchers should implement multiple electrophysiological protocols:

  • Voltage-dependent activation and inactivation should be tested using standard voltage protocols with step depolarizations from holding potentials

  • Inactivation kinetics should be quantified by measuring the time constant of inactivation (τ) across multiple voltages

  • Recovery from inactivation should be assessed using double-pulse protocols with varying interpulse intervals

  • For heterozygous mutations, co-expression of wild-type and mutant channels should be performed to simulate the in vivo condition

These approaches enable comprehensive assessment of mutation effects on channel function, as demonstrated in the characterization of the p.S447R mutation .

How can researchers effectively study the regulatory pathways affecting KCND2?

To investigate regulatory mechanisms affecting KCND2 function, researchers should consider:

  • Implementing PKC activation experiments using phorbol esters such as PMA

  • Comparing membrane expression levels between wild-type and mutant channels using surface biotinylation or immunofluorescence techniques

  • Creating phosphorylation site mutants (e.g., serine to alanine substitutions) to examine the specific roles of individual phosphorylation sites

  • Employing pharmacological inhibitors of relevant kinases to dissect regulatory pathways

These methodologies can reveal how mutations affect not only channel biophysical properties but also their regulation by cellular signaling pathways .

What mechanisms link KCND2 mutations to atrial fibrillation?

The connection between KCND2 mutations and atrial fibrillation involves specific changes in channel function that alter cardiac electrophysiology. The p.S447R mutation identified in autosomal dominant early-onset nocturnal paroxysmal atrial fibrillation demonstrates how KCND2 alterations contribute to arrhythmogenesis through multiple mechanisms:

  • Slower inactivation: The mutation significantly decreases the rate of channel inactivation, with the time constant of inactivation (τ) increasing from 27.4±1.5 ms in wild-type to 40.7±2.8 ms in mutant channels at 70 mV

  • Slightly faster recovery from inactivation: The time constant decreases from 32.6±2.2 ms in wild-type to 27.2±1.3 ms in mutant channels

  • Impaired PKC regulation: The mutation affects the PKC phosphorylation site at Ser447, leading to impaired response to PKC activation and consequently increased membrane expression of Kv4.2

How do heterozygous KCND2 mutations manifest functionally compared to homozygous mutations?

When heterozygous KCND2 mutations are present (as in affected individuals), the functional outcomes reflect the interaction between mutant and wild-type channels. Studies mimicking heterozygosity through co-expression of wild-type and mutant channels demonstrate that the gain-of-function effect observed in mutant channels persists in the heterozygous state. For example, with the p.S447R mutation, the heterozygous condition shows an intermediate inactivation rate (τ = 35.7±2.3 ms) between wild-type (27.4±1.5 ms) and homozygous mutant (40.7±2.8 ms) channels. This explains how heterozygous mutations can still significantly impact cardiac electrophysiology and cause dominant disorders like paroxysmal atrial fibrillation .

What evidence supports KCND2 as a biomarker in cancer progression?

Recent research has identified KCND2 as a potential prognostic biomarker in gastric cancer, with evidence indicating:

  • KCND2 expression is markedly elevated in gastric cancer tissues

  • KCND2 expression levels correlate with different tumor grades, T stages, and N stages

  • High KCND2 expression is associated with unfavorable prognosis in gastric cancer patients

  • KCND2 functions as an independent predictor of prognosis

These findings suggest that KCND2 expression analysis could provide valuable prognostic information for patients with gastric cancer .

Through what molecular mechanisms does KCND2 influence cancer cell proliferation?

KCND2 appears to enhance cancer cell proliferation through several molecular mechanisms:

  • Activation of the NF-κB signaling pathway, which promotes cell proliferation and survival

  • Enhancement of cell viability and reduction of apoptosis

  • Modulation of cell cycle progression

  • Potential alteration of cellular ionic homeostasis affecting proliferative signaling

These mechanisms contribute to KCND2's role in promoting gastric cancer progression. The NF-κB pathway appears particularly important, as KCND2 stimulates this pathway both in cell culture and animal models .

How does KCND2 interact with the tumor immune microenvironment?

KCND2 appears to modulate the tumor immune microenvironment by:

  • Promoting M2 macrophage infiltration, which are known to support tumor progression

  • Activating the NF-κB pathway, which regulates immune cell function

  • Potentially altering the balance between pro-inflammatory and anti-inflammatory signals in the tumor microenvironment

These interactions suggest that KCND2 not only directly affects cancer cell biology but also shapes the tumor microenvironment to favor cancer progression. The association with M2 macrophages is particularly significant, as these cells play critical roles in promoting tumor growth, angiogenesis, and immunosuppression .

What is the evidence linking KCND2 variants to autism spectrum disorders?

KCND2 has been implicated in autism spectrum disorders through several lines of evidence:

  • A de novo missense variant (p.Val404Met) was identified in monozygotic twins affected with autism and severe, intractable seizures

  • Functional analysis of this variant revealed pathogenic characteristics, specifically showing significantly slowed inactivation consistent with a gain-of-function effect

  • Genome-wide association studies involving 2165 participants from the Autism Genetic Resource Exchange (AGRE) found that a specific item on the Social Responsiveness Scale (SRS) - "has overly serious facial expressions" - significantly associates with the KCND2 gene

  • KCND2 has a SFARI Gene Score of 2, indicating strong evidence for its involvement in autism spectrum disorders

These findings suggest that alterations in KCND2 function may contribute to the neurobiological basis of autism and associated seizure disorders .

How might altered KCND2 function contribute to neuronal hyperexcitability and seizures?

Alterations in KCND2 function, particularly gain-of-function mutations like p.Val404Met, can lead to neuronal hyperexcitability and seizures through several mechanisms:

  • Slower inactivation of potassium channels alters the repolarization phase of the action potential

  • Changes in neuronal firing patterns due to modified A-type potassium currents

  • Disruption of the balance between excitatory and inhibitory neurotransmission

  • Potential alterations in synaptic plasticity and network synchronization

These changes can create a hyperexcitable neuronal environment that predisposes to seizures, as observed in the autism cases with the p.Val404Met mutation. Understanding these mechanisms provides insight into the neurophysiological basis of seizures in neurodevelopmental disorders .

How do the functional effects of KCND2 mutations differ between cardiac and neurological disorders?

CharacteristicCardiac Disorder (p.S447R)Neurological Disorder (p.Val404Met)
LocationC-terminal domain (PKC phosphorylation site)Transmembrane/pore region
Inactivation kineticsSlower inactivation (τ increased by ~48%)Significantly slowed inactivation
Recovery from inactivationSlightly fasterNot fully characterized
Regulatory impactImpaired PKC regulationNot primarily a regulatory mutation
Membrane expressionIncreasedNot specifically reported
Clinical manifestationNocturnal paroxysmal atrial fibrillationAutism with severe seizures
Inheritance patternAutosomal dominantDe novo occurrence

This comparison illustrates how different KCND2 mutations can lead to distinct clinical phenotypes despite similar biophysical effects (gain-of-function), highlighting the importance of precise channel regulation in different tissues .

What experimental approaches can reconcile seemingly contradictory findings in KCND2 research?

To address contradictory findings in KCND2 research, researchers should consider multiple approaches:

  • Implement tissue-specific expression systems that better reflect the native cellular environment of KCND2 in different tissues

  • Study channel function in the context of relevant auxiliary subunits and interacting proteins that may modify channel properties

  • Develop in vivo models that can capture the complex physiological context of KCND2 function

  • Utilize computational modeling to integrate biophysical data with systems-level understanding

  • Consider the broader signaling networks and compensatory mechanisms that may influence the ultimate impact of KCND2 alterations

These approaches can help resolve apparent contradictions by accounting for the complexity of KCND2 function across different cellular contexts and physiological systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.