Recombinant Human Potassium voltage-gated channel subfamily D member 3 (KCND3)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

KCND3 encodes the Kv4.3 channel, a pore-forming α-subunit of rapidly inactivating A-type potassium channels. These channels contribute to:

  • Cardiac transient outward potassium current (I~to1~): Essential for phase 1 repolarization of cardiac action potentials .

  • Neuronal excitability: Modulates action potential duration and firing frequency in Purkinje neurons .

Recombinant KCND3 is generated using heterologous expression systems (e.g., insect cells, HEK293) to produce functional channels for biochemical and electrophysiological studies .

Cardiac Arrhythmia Studies

  • Atrial Fibrillation (AF): The T361S mutation in KCND3 increases I~to~ current density and alters activation/inactivation kinetics, contributing to early-onset AF. Recombinant T361S-Kv4.3 expressed in HEK293 cells showed:

    • Hyperpolarizing shift: Steady-state activation (∆V~1/2~ = -9.29 mV) and inactivation (∆V~1/2~ = -13.14 mV) .

    • Delayed recovery: Slower reactivation (τ = 81.17 ms vs. 27.33 ms in wild type) .

Neurological Disorders

  • Spinocerebellar Ataxia (SCA19/22): The V374A mutation reduces Kv4.3 peak currents by ~81% via dominant-negative effects, impairing cerebellar function .

  • Paroxysmal Ataxia: Acetazolamide-responsive exacerbations linked to Kv4.3 dysfunction were modeled using recombinant V374A subunits .

Key Research Findings

MutationEffect on Kv4.3Disease AssociationStudy
T361S↑ I~to~ density, hyperpolarizing shiftsEarly-onset atrial fibrillation HEK293 cells
V374A↓ Peak current (dominant-negative)SCA19/22, paroxysmal ataxia Xenopus oocytes
G306SDe novo channel dysfunctionEncephalopathy, cardiac arrhythmias Clinical case

Challenges and Future Directions

  • Complex Gating: Interactions with β-subunits (e.g., KChIP2) complicate in vitro reconstitution .

  • Therapeutic Targeting: Modulating Kv4.3 activity could treat arrhythmias or neurodegenerative diseases, but specificity remains a hurdle .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KCND3; Potassium voltage-gated channel subfamily D member 3; Voltage-gated potassium channel subunit Kv4.3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-655
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCND3
Target Protein Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLER YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTST LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLL HCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHP GLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDG LRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL
Uniprot No.

Target Background

Function
The pore-forming (alpha) subunit of voltage-gated, rapidly inactivating A-type potassium channels. It may contribute to the ITo current in the heart and the ISa current in neurons. Channel properties are modulated by interactions with other alpha subunits and regulatory subunits.
Gene References Into Functions
  1. Mutations cause a gain-of-function in KV4.3/KChIP2-encoded channels by increasing membrane protein expression and slowing channel inactivation. PMID: 26016905
  2. Mefloquine acts as a concentration-dependent ITo and hKv4.3 channel blocker. PMID: 26216464
  3. Altered Kv4.3 channel localization and/or function resulting from SCA19/22 mutations may lead to Purkinje cell loss, neurodegeneration, and ataxia. PMID: 25854634
  4. The interaction of DPP10a, expressed in the human atrium, with Kv4.3 channels generates a sustained current component of ITo, potentially affecting the late repolarization phase of atrial action potentials. PMID: 25600224
  5. Kv4.3 K+ channels are implicated in heart hypertrophy/heart failure independently of their electrical function. [review] PMID: 24762397
  6. SEMA3A is identified as a naturally occurring protein that selectively inhibits Kv4.3, suggesting it as a potential Brugada syndrome susceptibility gene via a Kv4.3 gain-of-function mechanism. PMID: 24963029
  7. Maps to chromosome 1p21-q21 and identified in a Dutch autosomal dominant cerebellar ataxia family. PMID: 12384780
  8. These results indicate that Kv4.3 is a likely target of discrepin, highlighting the importance of the basic residue K13, located in the toxin's alpha-helix, for current blockage. PMID: 24845726
  9. Findings indicate that KCND3 mutations are not a common cause of rarer European cerebellar ataxias; however, two variants (p.L450F and p.P614S) were identified in SCA cases. KCND3 mutations can cause two allelic disorders, SCA19/22 and Brugada syndrome, which may co-occur. PMID: 23963749
  10. Reports a KV4.3 gain-of-function mutation in early-onset persistent lone atrial fibrillation. PMID: 23400760
  11. Examines the expression of sodium (SCN5A) and potassium (KCND3) channels, as well as fibrosis content in the ventricles of heart failure and non-diseased hearts under varying post-mortem intervals. PMID: 23036686
  12. The biophysical characteristics of Kv4.3 channels are strongly temperature-dependent. PMID: 23291429
  13. Demonstrates that mutations in KCND3 cause spinocerebellar ataxia type 22 in Chinese and Japanese populations. PMID: 23280837
  14. Demonstrates that KCND3 mutations cause SCA19 through impaired protein maturation and/or reduced channel function. PMID: 23280838
  15. KCND3 may represent a rare genetic substrate in the pathogenesis of autopsy-negative sudden unexplained death (SUD), but not sudden infant death syndrome (SIDS) cases. PMID: 22457051
  16. Human atrial ITo and cloned hKv4.3 channels are modulated by EGFR kinase via phosphorylation of the Y136 residue and by Src-family kinases via phosphorylation of the Y108 residue. PMID: 22198508
  17. Provides deep insights into the mechanism of Kv4.3 K+ channel regulation and their role in cell death. PMID: 22023388
  18. Further research on the Kv4.3 macromolecular complex and regulators of KCND3 expression is needed to elucidate the role of the ITo current in the pathogenesis of BrS and other J-wave syndromes. PMID: 21349352
  19. The "structurally minimal" isoform KChIP2d modulates recovery of the Kv4.3 N-terminal deletion mutant Δ2-39. PMID: 21422811
  20. Findings suggest that KChIP1 interacts with Kv4.3 in interneurons at the stratum lacunosum-moleculare/radiatum junction. PMID: 21129448
  21. The ITo activator NS5806 modifies Kv4.3/KChIP2 gating in several ways that inhibit current. PMID: 20649599
  22. KChIP4a promotes tetrameric assembly and enhances surface expression of Kv4 channels. PMID: 20550899
  23. N-linked glycosylation of DPP10 plays a significant role in modulating Kv4.3 channel/KCHIP2 complex activities. PMID: 20354865
  24. Down-regulated atrial KChIP2 and Kv4.3 mRNA expression in rheumatic heart disease patients with chronic atrial fibrillation may contribute to the down-regulation of ITo current density in atrial fibrillation. PMID: 19927631
  25. Kv4.3 promiscuously assembles with ancillary subunits in vitro, functionally modifying the encoded currents. PMID: 12297301
  26. Analysis with chimeric proteins between KChIP2 and NCS-1 reveals that three regions of KChIP2 are necessary and sufficient for its effective binding to Kv4.3 protein. PMID: 12928444
  27. Two arginines in the cytosolic C-terminal domain of Kv4 subfamily alpha-subunits strongly regulate the voltage dependence of channel activation, inactivation, and recovery. PMID: 14645239
  28. Both Kv4.3 and KChIP2 may contribute to epicardial-endocardial gradients in the transient outward current in normal and failing hearts. PMID: 15498806
  29. Co-expression of SGK1, but not SGK2 or SGK3, increased Kv4.3/KChIP2b channel currents. PMID: 15578212
  30. Co-expression of DPPX, along with Kv4.3 and KChIP2a, produced current kinetics similar to those observed in human ventricular myocytes. PMID: 15890703
  31. KCNE3 also inhibits currents generated by Kv4.3 in complex with the accessory subunit KChIP2. PMID: 16782062
  32. The mechanisms involved in Syn1A-Kv interactions vary significantly between Kv channels, offering broad scope for Syn1A modulation of exocytosis and membrane excitability. PMID: 17506992
  33. Kv4.3 regulates angiotensin type 1 receptor signaling to the small G-protein Rap-1. PMID: 17725712
  34. KCND3 mutations were not found to directly cause long QT syndrome. PMID: 18052691
  35. c-Src-induced Kv4.3 channel activation involves their association within a macromolecular complex. PMID: 18620005
  36. NO and NO donors inhibited IKv4.3 in a concentration- and voltage-dependent manner. PMID: 18678642
Database Links

HGNC: 6239

OMIM: 605411

KEGG: hsa:3752

STRING: 9606.ENSP00000319591

UniGene: Hs.666367

Involvement In Disease
Spinocerebellar ataxia 19 (SCA19); Brugada syndrome 9 (BRGDA9)
Protein Families
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.3/KCND3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell membrane, sarcolemma; Multi-pass membrane protein. Cell projection, dendrite.
Tissue Specificity
Highly expressed in heart and brain, in particular in cortex, cerebellum, amygdala and caudate nucleus. Detected at lower levels in liver, skeletal muscle, kidney and pancreas. Isoform 1 predominates in most tissues. Isoform 1 and isoform 2 are detected a

Q&A

What is the basic structure of the KCND3-encoded Kv4.3 channel?

Kv4.3 is a six transmembrane-segmented (S1-S6) ion channel involved in transient outward K+ current. The S1-S4 segments form the voltage-sensing domain, while S5 and S6 segments with the pore loop constitute the ion-selective pore (H5). Structural analysis using crystallography and the AlphaFold Protein Structure Database reveals that Kv4.3 forms homo- or heterotetramers with other members of the Shal subfamily channels, creating functional ion channels that regulate membrane repolarization in excitable cells . When analyzing recombinant Kv4.3 proteins, researchers should acknowledge that even single amino acid substitutions in conserved regions can significantly alter channel conformation and function.

Where is KCND3/Kv4.3 predominantly expressed in neural tissues?

Kv4.3 is highly expressed throughout the central nervous system, with particularly strong expression in cerebellar Purkinje cells, deep nuclei, granule cells, and interneurons . Pre- and postmigrating Purkinje cells show different levels of Kv4.3 expression, suggesting a developmental role in cerebellar formation . When designing neuronal cell models for KCND3 functional studies, researchers should consider this differential expression pattern, as it may impact the physiological relevance of their experimental system. Immunohistochemical studies have confirmed this expression pattern, making cerebellar tissue and cerebellar-derived cell lines particularly valuable for studying Kv4.3 function.

How does Kv4.3 contribute to neuronal excitability?

Kv4.3 channels mediate the transient outward K+ current, which is crucial for membrane repolarization in excitable cells including neurons . In cerebellar Purkinje cells, these channels regulate intrinsic autonomous firing patterns and modulate neuronal inputs . Computational modeling of neuronal activity has demonstrated that alterations in Kv4 conductance can significantly impact Purkinje neuron firing patterns and cerebellar circuit function . When studying neuronal excitability, electrophysiological recordings must account for the specific kinetics of Kv4.3-mediated currents, which typically show rapid activation and inactivation compared to other potassium channels.

What are the optimal expression systems for studying recombinant KCND3?

For functional characterization of Kv4.3 channels, several expression systems have proven effective:

  • Xenopus laevis oocytes: Widely used for electrophysiological studies due to low endogenous channel expression and large size facilitating two-electrode voltage-clamp recordings . This system allows for controlled expression of wild-type and mutant channels, as well as co-expression with auxiliary subunits like KChIPs.

  • Mammalian cell lines (HEK293, CHO): Provide a more physiologically relevant environment for mammalian protein expression and are suitable for patch-clamp electrophysiology and trafficking studies .

  • Patient-derived iPSCs: Enable the study of KCND3 mutations in human neuronal context, particularly valuable for investigating disease mechanisms .

The choice between these systems depends on the specific research question, with iPSCs being particularly powerful for disease modeling despite their technical complexity and higher variability.

How can researchers effectively model KCND3 mutations associated with neurological disorders?

Multiple approaches can be employed to model KCND3 mutations:

  • Patient-derived iPSCs: As demonstrated in recent studies , iPSCs can be differentiated into neurons to study the effects of mutations on channel function and cellular pathophysiology. This method preserves the patient's genetic background and allows for longitudinal studies of neuronal development and degeneration.

  • Heterologous expression systems: Wild-type and mutant Kv4.3 can be expressed in systems like Xenopus oocytes or HEK293 cells to compare their electrophysiological properties . This approach demonstrated that the V374A mutation renders Kv4.3 non-functional when expressed alone and exerts dominant negative effects when co-expressed with wild-type channels.

  • Computational modeling: In silico mutagenesis and electrostatic potential analysis can predict structural and functional consequences of mutations . The HOLE algorithm and Adaptive Poisson-Boltzmann Solver (APBS) have been used to analyze how mutations affect channel pore geometry and electrostatic properties.

Each approach has strengths and limitations; combining multiple methods provides the most comprehensive understanding of mutation effects.

What electrophysiological techniques are most suitable for characterizing Kv4.3 channel function?

Several electrophysiological techniques are employed to study Kv4.3 channels:

TechniqueAdvantagesLimitationsBest Applications
Two-electrode voltage-clamp (TEVC)Stable recordings, suitable for high-throughput screeningLimited to larger cells (e.g., Xenopus oocytes)Initial characterization of wild-type vs. mutant channels
Whole-cell patch-clampHigh resolution, applicable to mammalian cellsTechnically challenging, dialysis of cell contentsDetailed kinetic analysis, studying modulation by intracellular factors
Outside-out patchIsolates channel behavior from cellular machineryLow channel numbers, complex analysisSingle channel kinetics, pharmacological studies
Dynamic clampCan test channel models in live neuronsRequires sophisticated equipmentTesting computational predictions in actual neurons

For recombinant KCND3 studies, protocols should include voltage steps from -80mV to +40mV to fully characterize activation properties, and pre-pulses to +40mV followed by steps to various potentials to study inactivation kinetics .

How do loss-of-function versus gain-of-function KCND3 mutations manifest differently?

Research has established distinct phenotypic outcomes based on mutation effect:

Loss-of-function mutations:

  • Associated primarily with neurological phenotypes, particularly SCA19/22

  • Often lead to protein misfolding, retention in the endoplasmic reticulum, and reduced surface expression

  • Trigger endoplasmic reticulum stress (ERS) and potential neuronal apoptosis through the PERK-ATF4-CHOP pathway

  • Examples include the c.1130 C>T (p.T377M) mutation, which causes protein misfolding and degradation

Gain-of-function mutations:

  • Primarily associated with cardiac phenotypes including Brugada syndrome and early-onset atrial fibrillation

  • Typically alter channel gating properties rather than expression levels

  • May accelerate repolarization in cardiac tissue

  • Located predominantly in the C-terminus of the protein

When studying novel KCND3 mutations, researchers should conduct both expression/trafficking analyses and electrophysiological characterization to determine whether the mutation causes loss or gain of function.

What molecular mechanisms underlie KCND3 mutation-induced neurotoxicity?

Recent studies have elucidated a potential pathway linking KCND3 mutations to neurodegeneration:

  • Mutations like p.T377M cause misfolding of Kv4.3 protein

  • Misfolded proteins accumulate in the endoplasmic reticulum

  • This activates the endoplasmic reticulum-associated degradation (ERAD) pathway

  • Prolonged ER stress triggers the unfolded protein response (UPR)

  • Activation of the PERK-ATF4-CHOP pathway is observed

  • ATF4 and CHOP upregulation leads to Bcl2-mediated neuronal apoptosis

Transcriptome analysis of SCA19/22 patient-derived neurons revealed significant enrichment of genes involved in protein processing in the endoplasmic reticulum, supporting this mechanism . Western blotting showed reduction in Kv4.3 levels with concurrent increases in ATF4 and CHOP, key mediators of ER stress-induced apoptosis.

How do specific amino acid substitutions affect Kv4.3 channel properties?

Different mutations impact channel function through distinct mechanisms:

MutationLocationFunctional EffectStructural ConsequenceReference
p.T377MS5-S6 loopLoss of functionPolar to nonpolar substitution causing enlargement at residue 377
p.F227delS2-S3 loopReduced current amplitudeDisrupted channel assembly/trafficking
p.V374AS5-S6 regionNon-functional (dominant negative)Affects pore structure
p.S301PS4 domainNeurodevelopmental phenotypeAltered interaction between transmembrane domain and lipid membrane

Computational structure modeling using tools like AlphaFold has been valuable in predicting how mutations affect protein structure. The conservation analysis of affected residues across species provides additional insight into mutation pathogenicity .

What is the clinical spectrum of KCND3 mutations in neurological disorders?

Research has identified two main clinical phenotypes based on age of onset :

Early-onset forms:

  • Neurodevelopmental disorder with epilepsy and/or movement disorders

  • Ataxia developing later in the disease course

  • Cognitive impairment/intellectual disability present in all reported cases

  • May include psychiatric symptoms

  • Example: p.S301Pro mutation presents with neurodevelopmental disorder, epilepsy, parkinsonism-dystonia, and ataxia in adulthood

Late-onset forms:

  • Predominant ataxic syndrome starting in adulthood

  • Possible cognitive decline (in ~25% of patients)

  • May include movement disorders

  • Peripheral neuropathy in some cases

  • Generally slower progression

  • Example: p.T377M mutation presents with head tremor, progressive ataxia

A comprehensive review of 68 reported cases demonstrated this phenotypic dichotomy, suggesting different pathophysiological mechanisms based on mutation type and location .

How do researchers assess disease severity and progression in KCND3-related ataxias?

Several validated scales are employed to quantify neurological dysfunction:

  • Assessment and Rating of Ataxia (SARA): Measures cerebellar ataxia severity on a 0-40 scale

  • International Cooperative Ataxia Rating Scale (ICARS): More detailed assessment of ataxic symptoms

  • MDS-Unified Parkinson's Disease Rating Scale (MDS-UPDRS): Evaluates parkinsonian features

  • Mini-Mental State Examination (MMSE): Screens for cognitive impairment

Neuroimaging approaches include:

  • MRI to assess cerebellar atrophy and white matter abnormalities

  • FDG-PET to evaluate metabolic activity (hypometabolism particularly in cerebellum)

Longitudinal studies employing these measures provide valuable data on disease progression rates and potential biomarkers .

What is the evidence for genotype-phenotype correlations in KCND3-related disorders?

Emerging research suggests correlation between mutation characteristics and clinical presentation:

  • Mutation location: Mutations in different functional domains (voltage sensor, pore region, cytoplasmic domains) correlate with different phenotypes

  • Functional impact: Mutations causing complete loss of function tend to produce more severe phenotypes than those with partial function retention

  • Age of onset: Early-onset cases (childhood) tend to have more complex phenotypes including neurodevelopmental disorders and epilepsy

  • System involvement: Some mutations preferentially affect the cerebellum, while others have wider neurological impact

How can researchers better elucidate the role of KCND3 in neurodevelopment?

Future research should explore:

  • Temporal expression patterns: Using single-cell transcriptomics to map Kv4.3 expression during cerebellar development

  • Conditional knockout models: Employing temporal and cell-type-specific Kv4.3 deletion to determine critical developmental windows

  • Human brain organoids: Developing cerebellum-specific organoids from iPSCs with KCND3 mutations to study developmental trajectories

  • In vivo calcium imaging: Monitoring neuronal circuit formation in developing systems with normal and mutant Kv4.3

These approaches could reveal why some KCND3 mutations cause neurodevelopmental phenotypes while others primarily affect mature neurons, potentially identifying critical developmental checkpoints where Kv4.3 function is essential .

What therapeutic strategies show promise for KCND3-related disorders?

Several potential approaches warrant investigation:

  • Chemical chaperones: Molecules that assist proper protein folding might rescue trafficking-deficient Kv4.3 mutants

  • ERAD pathway modulators: Compounds that regulate the endoplasmic reticulum-associated degradation pathway could prevent excessive degradation of mutant channels

  • UPR modulators: Targeting the unfolded protein response, particularly the PERK-ATF4-CHOP pathway, might prevent neuronal apoptosis

  • Gene therapy approaches:

    • Antisense oligonucleotides to selectively suppress mutant alleles

    • CRISPR-based strategies for gene correction

  • Compensatory ion channel modulation: Targeting other K+ channels to restore appropriate neuronal excitability

Preclinical studies suggest that channel modulators may alleviate movement disorders by regulating neuronal inputs to Purkinje neurons . Testing these approaches in patient-derived iPSC neurons represents a logical next step.

How can advanced computational modeling enhance our understanding of KCND3 channel dynamics?

Sophisticated computational approaches offer several advantages:

  • Molecular dynamics simulations: Can model conformational changes during channel gating and predict how mutations disrupt these processes

  • Markov models: Can capture complex gating behaviors and transitions between channel states

  • Integration with neuronal network models: Linking channel-level dysfunction to circuit-level abnormalities in cerebellar networks

  • Machine learning approaches:

    • Predicting mutation pathogenicity from sequence and structural features

    • Identifying potential binding sites for therapeutic compounds

Recent work using the HOLE algorithm and electrostatic potential analysis with the Adaptive Poisson-Boltzmann Solver has demonstrated the value of these approaches . Combining computational modeling with experimental validation in expression systems and patient-derived neurons represents the cutting edge of KCND3 research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.