Recombinant Human Potassium voltage-gated channel subfamily E member 1 (KCNE1)

Shipped with Ice Packs
In Stock

Description

Functional Roles

KCNE1 modulates multiple ion channels through distinct mechanisms:

Primary Interaction with KCNQ1

KCNE1 co-assembles with KCNQ1 to form the IKs channel, critical for:

  • Cardiac repolarization: Slows activation kinetics of KCNQ1, enabling prolonged repolarization in ventricular cardiomyocytes .

  • Epithelial ion transport: Regulates potassium secretion in the inner ear and kidneys .

Modulatory Effects on KCNQ1:

ParameterKCNQ1 AloneKCNQ1 + KCNE1Mechanism
Activation KineticsRapid (ms range)Slowed (100–200 ms)KCNE1 restricts S4-S5 linker movement, delaying voltage sensor activation .
Unitary Conductance~4 pS~16 pSKCNE1 stabilizes the open state and enhances pore permeability .
InactivationPresentAbsentKCNE1 disrupts inactivation gate formation .

Secondary Interactions

KCNE1 also regulates other Kv channels:

ChannelEffectMechanism
hERGDoubles current amplitude .Unknown; may involve altered trafficking or gating .
Kv4.3Slows activation/deactivation; increases macroscopic current .Modifies voltage sensor movement and pore dynamics .
Anoctamin-1Enhances calcium-dependent chloride conductance .Forms a heteromeric complex, enabling voltage/calcium coupling .

Genetic and Clinical Implications

Mutations in KCNE1 are linked to severe cardiac and auditory disorders:

DisorderGenetic BasisClinical Features
Jervell and Lange-Nielsen SyndromeHomozygous mutations (e.g., V47F, S74L) .Congenital deafness + long QT syndrome (LQT5) → arrhythmias, sudden death .
Romano-Ward SyndromeHeterozygous mutations (e.g., D76N, A97S) .Long QT syndrome (LQT5) → arrhythmias, often without deafness .
Acquired Long QT SyndromePolymorphisms (e.g., S38F) in drug-sensitive patients .Drug-induced arrhythmias (e.g., with sotalol, macrolides) .

Key Mutations:

  • V47F: Disrupts KCNE1-KCNQ1 interaction, abolishing IKs .

  • S74L: Impairs SGK1-mediated phosphorylation, reducing channel activity .

Research and Therapeutic Advances

Recent studies highlight KCNE1’s role in channel regulation and disease:

Therapeutic Strategies

ApproachMechanismStatus
ML277Binds KCNQ1’s central pore, rescuing PKA sensitivity in LQT1 mutants .Preclinical (tested in iPSC-derived cardiomyocytes) .
Small Molecule ModulatorsTarget KCNE1-KCNQ1 interaction to restore IKs function .Experimental (e.g., chromanol 293B, azimilide) .

Recombinant KCNE1 Applications

Recombinant KCNE1 is used in:

ApplicationDetailsSources
ElectrophysiologyCo-expressed with KCNQ1 in Xenopus oocytes or HEK293 cells to study IKs .Purified in LMPG micelles; retains native function .
Structural StudiesNMR and cryo-EM to resolve KCNE1-KCNQ1 interactions .Used to dock KCNE1 TMD into KCNQ1 models .
Therapeutic ScreeningHigh-throughput assays to identify IKs modulators .ML277 identified via patient-specific iPSC models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCNE1; Potassium voltage-gated channel subfamily E member 1; Delayed rectifier potassium channel subunit IsK; IKs producing slow voltage-gated potassium channel subunit beta Mink; Minimal potassium channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNE1
Target Protein Sequence
MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
Uniprot No.

Target Background

Function
KCNE1 is an ancillary protein that assembles as a beta subunit within a voltage-gated potassium channel complex comprising pore-forming alpha subunits. It plays a crucial role in modulating the gating kinetics and enhancing the stability of the channel complex. When assembled with KCNB1, it modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. The assembly of KCNE1 with KCNQ1/KVLQT1 is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel, where the outward current reaches its steady state only after 50 seconds. In association with KCNH2/HERG, KCNE1 may modulate the rapidly activating component of the delayed rectifying potassium current in the heart (IKr).
Gene References Into Functions
  1. The S38G mutation in KCNE1 led to a loss-of-function of IKs due to decreased KCNE1 protein expression and impaired KCNE1 protein membrane trafficking. PMID: 29395134
  2. Extensive molecular dynamics simulations were used to refine the models of protein systems generated through various processes. These refined models were analyzed to gain insights into the interaction of the KCNQ1 channel with its accessory KCNE1 beta subunits. PMID: 28992529
  3. Analysis of lesion samples from children with cardiac insufficiency revealed significant differences in AA and CC genotype frequencies and allele frequencies between the observation group and the control group for Mink-S27. PMID: 28829496
  4. SUMOylation of KCNQ1 is dependent on KCNE1 and plays a critical role in determining the native attributes of cardiac IKs in vivo. PMID: 28743749
  5. Equine KV7.1/KCNE1 expressed in CHO-K1 cells exhibited electrophysiological properties broadly similar to those of human orthologs. However, a slower deactivation was observed, potentially leading to a higher number of open channels at rapid rates. PMID: 28917093
  6. The KCNE1 (rs1805127) polymorphism appears to be an independent risk factor for atrial fibrillation (AF) in the Uygur population. Additionally, KCNE4 (rs12621643) was identified as an independent risk factor for AF in both Uygur and Han populations. PMID: 28981946
  7. Western blotting analysis, combined with pharmacological data, suggests that long-term insulin treatment enhances KCNQ1/KCNE1 currents by increasing KCNE1 protein expression. PMID: 28882596
  8. The KCNQ1/KCNE1 channel does not require phosphatidylinositol-4,5-bisphosphate (PIP2) or phosphatidylinositol-4-phosphate for anterograde trafficking but heavily relies on PIP2 for channel function once it reaches the plasma membrane. PMID: 29020060
  9. Genetic variants rs426496 in AQP2, rs591810 in AQP3, and rs1805127, rs1805128, and rs17173510 in KCNE1 were identified in patients with Meniere's disease. PMID: 27509294
  10. Meta-analysis indicates that the G38S polymorphism in the KCNE1 gene significantly increases the risk of atrial fibrillation in both Chinese and white individuals. PMID: 28640127
  11. Sphingomyelin synthase 1 positively regulates KCNQ1/KCNE1 channel density in a protein kinase D-dependent manner. PMID: 27194473
  12. Receptor species-dependent desensitization controls KCNQ1/KCNE1 K+ channels as downstream effectors of Gq protein-coupled receptors. PMID: 27834678
  13. KCNE1 encodes a modulator of KCNQ1 and KCNH2 channels. Long QT syndrome (LQTS) patients with KCNE1(G38S) exhibited a rate-dependent repolarization abnormality similar to patients with LQT2, potentially increasing the risk of developing lethal arrhythmias. PMID: 27255646
  14. A 4:4 stoichiometry between the alpha KCNE1 and the beta KCNQ1 subunits has been established. PMID: 26802629
  15. Based on current evidence from published studies, neither of the two variants from KCNE was significantly associated with the risk of Meniere's disease. PMID: 26890422
  16. Analysis of the QT-RR relationship can also evaluate the latent arrhythmogenicity of KCNE1(G38S). PMID: 26520166
  17. The incidence of AF among the senior Uygur population in the Xinjiang territory was correlated with the KCNE1 (G38S) polymorphism, suggesting it may be an independent risk factor for Uygur AF patients. PMID: 26662381
  18. The KCNQ1 F279I mutation induces a gain of function of IKs due to impaired gating modulation of Kv7.1 induced by KCNE1, leading to a shortening of the cardiac action potential. PMID: 26168993
  19. This study aimed to assess the associations between polymorphisms in KCNE1, KCNQ1, and KCNH2 with the risk of AF in a Chinese population. PMID: 26066992
  20. KCNE1 and KCNE3: The yin and yang of voltage-gated K(+) channel regulation. PMID: 26410412
  21. Two phenylalanine residues on KCNQ1, Phe232 on S4 (VSD) and Phe279 on S5 (pore domain), were identified as being responsible for the gating modulation by KCNE1. PMID: 24920132
  22. Acute application of polyunsaturated fatty acids (PUFAs) increases Kv7.1/KCNE1, likely through a direct effect, and demonstrates antiarrhythmic efficacy under IKr block. PMID: 25497550
  23. IKs phosphorylation and alpha1-AR regulation via activation of calcium-dependent PKC isoforms (cPKC) may be a key mechanism for controlling channel voltage-dependent activation and consequently action potential duration (APD) in response to adrenergic stimulation. PMID: 25479336
  24. The distal C-terminus of KCNE1 appears essential for the regulation of yotiao-mediated PKA phosphorylation. PMID: 25037568
  25. The KCNE1 112G polymorphism may be a risk factor for AF. KCNE1 112G>A may be a useful biomarker for predicting the development of AF. PMID: 25366730
  26. Klotho upregulates KCNQ1 and KCNE1 channel activity by enhancing channel protein abundance in the cell membrane. PMID: 24457979
  27. KCNE1-D85N is less stable than the wild-type protein and undergoes rapid degradation through the ubiquitin-proteasome system. Verapamil may have therapeutic value in LQTS patients by preventing degradation of KCNE1-D85N. PMID: 24499369
  28. The resilience of the curvature in the KCNE1 transmembrane domain is likely maintained upon binding of the protein to the KCNQ1 channel. PMID: 25234231
  29. A significant association between Mink S38G gene polymorphism and AF risk was observed. Carriers of the G allele may have a predisposition to AF. PMID: 24696659
  30. The A590T mutation in the KCNQ1 C-terminal helix D reduces KCNE1 channel trafficking and function but does not affect Yotiao interaction. PMID: 24713462
  31. Homozygous inheritance of KCNE1(38S) may cause a mild reduction in delayed rectifier K(+) currents, potentially increasing arrhythmogenic potential, especially in the presence of QT-prolonging factors. PMID: 24419801
  32. KCNE1 divides the voltage sensor movement in KCNQ1/KCNE1 channels into two distinct steps. PMID: 24769622
  33. The transmembrane domains (TMDs) of KCNE1 and KCNE2 were illustrated to associate with the KCNQ1 channel in different modes. PMID: 24827085
  34. The study concluded that variants in the KCNQ1, KCNH2, KCNE1, and KCNE2 genes may be correlated with the occurrence of some cases of sudden unexplained nocturnal death syndrome in southern China. PMID: 23890619
  35. This study confirmed the association of the 112G>A polymorphism with postoperative AF in a cohort of patients undergoing cardiac surgery. PMID: 24439990
  36. Subjects with LQT-PM may have longer QTc intervals at rest and at peak exercise and all phases of the recovery period compared to controls. Those with homozygous SNPs (KCNE1 35%) had longer resting QTc intervals when compared to heterozygotes. PMID: 23714088
  37. The KCNE1 rs1805127 polymorphism increases the risk of atrial fibrillation. PMID: 23874724
  38. KCNE1 maintained a stable cell surface localization, whereas KCNQ1 exhibited variations in the cytosolic compartment (striations versus vesicles) and the degree of presence on the cell surface of cardiac myocytes. PMID: 24142691
  39. The KCNE1 single nucleotide polymorphism contributed to tinnitus that developed independently of hearing loss. PMID: 23224734
  40. KCNE1 gene abnormalities and mutations are associated with the development of long QT syndrome. PMID: 23237912
  41. KCNE1 redirects the targeting-deficient KV7.1-Y51A mutant to the apical membrane of MDCK cells. PMID: 23324056
  42. Unsaturated heteromultimeric (KCNQ1)4(KCNE1)n channels are present as components of IKs and are pharmacologically distinct from KCNE-saturated KCNQ1-KCNE1 channels. PMID: 23650380
  43. KCNE1 and KCNE2, auxiliary subunits of voltage-gated potassium channels, undergo sequential cleavage mediated by either alpha-secretase and presenilin(PS)/gamma-secretase or BACE1 and PS/gamma-secretase in cells. PMID: 23504710
  44. The genetic polymorphism of KCNE1 was associated with an increased risk of AF in a Chinese Han population. PMID: 23020083
  45. The KCNE1 G38S polymorphism might have different impacts on AF in various ethnicities. PMID: 23129484
  46. Genotype screening revealed the KCNE1 D85N polymorphism, recognized as one of the typical disease-causing gene variants in long-QT syndrome (LQTS). PMID: 22999324
  47. IKs channels open slowly because KCNE1 accessory subunits slow the movement of S4 voltage sensors in KCNQ1 pore-forming subunits. PMID: 23359697
  48. KCNQ1 channels, both in the absence and presence of KCNE1, undergo sequential gating transitions leading to channel opening even before all VSDs have moved. PMID: 22908235
  49. Early-onset lone atrial fibrillation is associated with mutations in the potassium current channel regulatory subunit KCNE1. PMID: 22471742
  50. The KCNE1 variant rs1805128, resulting in D85N, confers a substantially increased risk for drug-induced torsades de pointes. PMID: 22100668

Show More

Hide All

Database Links

HGNC: 6240

OMIM: 176261

KEGG: hsa:3753

STRING: 9606.ENSP00000337255

UniGene: Hs.121495

Involvement In Disease
Jervell and Lange-Nielsen syndrome 2 (JLNS2); Long QT syndrome 5 (LQT5)
Protein Families
Potassium channel KCNE family
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Apical cell membrane. Membrane raft.
Tissue Specificity
Expressed in lung, kidney, testis, ovaries, small intestine, peripheral blood leukocytes. Expressed in the heart. Not detected in pancreas, spleen, prostate and colon. Restrictively localized in the apical membrane portion of epithelial cells.

Q&A

What is the normal function of KCNE1 protein?

The KCNE1 gene provides instructions for making a protein that regulates the activity of potassium channels. These channels transport positively charged potassium ions into and out of cells, playing a key role in a cell's ability to generate and transmit electrical signals. Specifically, KCNE1 protein functions as a beta subunit that binds to channels composed of alpha subunits produced from the KCNQ1 gene. This regulatory binding alters channel kinetics and conductance, critically influencing how potassium moves across cell membranes .

In physiological contexts, KCNE1-regulated channels are particularly active in the inner ear and cardiac muscle. Within the inner ear, these channels maintain the proper ion balance required for normal hearing functions. In cardiac tissue, they facilitate the recharging of cardiac muscle after each heartbeat to maintain regular rhythm. Additionally, KCNE1 is expressed in kidneys, testes, and uterus, where it likely regulates other channel activities .

How does KCNE1 interact with KCNQ1 to form functional channels?

KCNE1 interacts with KCNQ1 through specific binding domains that have been identified through molecular docking studies and experimental approaches. The KCNQ1-KCNE1 complex forms when beta subunits (KCNE1) associate with the alpha subunits (KCNQ1) of the channel. This association occurs with variable stoichiometry, meaning different numbers of KCNE1 subunits can bind to the KCNQ1 tetramer .

Research employing molecular docking techniques with Rosetta has revealed that KCNE1 binds to KCNQ1 in specific conformational states. These states are categorized as either resting/closed (RC) or activated/open (AO), with distinct binding patterns for each state. Experimental validation through disulfide crosslinking and site-directed mutagenesis confirmed these binding modes, demonstrating that certain residues at the KCNQ1-KCNE1 interface are critical for proper channel function .

What are the tissue-specific expression patterns of KCNE1?

KCNE1 expression has been identified in multiple tissues, with particularly significant functional roles in the inner ear and cardiac muscle. In these tissues, KCNE1-regulated potassium channels contribute to essential physiological processes. The expression pattern corresponds to the clinical manifestations observed in conditions caused by KCNE1 mutations, particularly affecting hearing and cardiac rhythm .

Beyond these primary sites, KCNE1 is also expressed in the kidneys, testes, and uterus. Though less extensively studied, KCNE1 likely regulates the activity of potassium channels in these tissues as well, potentially contributing to tissue-specific ion homeostasis mechanisms .

How does stoichiometry affect KCNQ1-KCNE1 channel properties?

The stoichiometric relationship between KCNQ1 and KCNE1 subunits fundamentally alters channel kinetics and conductance properties. Research has demonstrated that current activation becomes progressively slower as more KCNE1 subunits are incorporated into the KCNQ1 ion channel tetramer. This graduated effect reveals the sophisticated regulation possible through variable subunit composition .

Electrophysiological studies have shown that changes in macroscopic channel kinetics correspond to specific stoichiometric arrangements. The G-V curve of IKs (the slowly activating delayed rectifier potassium current) becomes progressively depolarized with increasing KCNE1 subunit incorporation. Furthermore, single channel measurements revealed increased conductance and longer latency to first opening in 4:4 complexes compared to configurations with fewer KCNE1 subunits (1:4, 2:4, and 0:4) .

KCNQ1:KCNE1 RatioActivation KineticsG-V Curve ShiftSingle Channel ConductanceLatency to First Opening
4:0 (KCNQ1 alone)RapidMore negativeLowerShorter
4:1SlowerIntermediateIntermediateIntermediate
4:2Slower stillIntermediateIntermediateIntermediate
4:4 (Full complex)SlowestMost positiveHighestLongest

These findings are supported by experiments using co-expression of KCNE1 with fixed 2:4 and 1:4 constructs, which demonstrated incorporation of free KCNE1 into spare sites and recapitulation of the properties observed in fully saturated 4:4 heteromeric channels .

What structural mechanisms underlie KCNE1's modulation of KCNQ1?

The structural basis for KCNE1 modulation of KCNQ1 has been investigated through molecular modeling guided by experimental restraints. Computational docking using Rosetta has revealed that KCNE1 binds to KCNQ1 in both closed and open conformational states, with distinct interaction patterns for each state .

Analyses of KCNQ1-KCNE1 interactions have identified critical contact points between the proteins. The pattern of KCNQ1-contacting positions in KCNE1 correlates with the functional impact of mutations at these positions. Specifically, residues with greater than 20% change in solvent-accessible surface area (ΔSASA) due to KCNQ1-KCNE1 binding are partially or fully buried in the interface and show higher sensitivity to mutation .

The allosteric mechanism for KCNE1 modulation involves conformational changes that alter channel gating. Experimental evidence from disulfide crosslinking studies indicates that specific residue pairs preferentially interact in either the closed or open state. For example, KCNE1 K41–KCNQ1 I145 and KCNE1 L42–KCNQ1 V324 crosslinks favor the open state, while KCNE1 K41–KCNQ1 V324 and KCNE1 L42–KCNQ1 I145 crosslinks stabilize the closed state .

How do mutations in KCNE1 contribute to cardiac arrhythmias and hearing loss?

Mutations in the KCNE1 gene have been directly linked to Jervell and Lange-Nielsen syndrome, a condition characterized by abnormal heart rhythm (arrhythmia) and profound hearing loss from birth. Approximately 10% of cases are caused by mutations in this gene, with affected individuals typically carrying mutations in both copies of the KCNE1 gene in each cell .

The pathophysiological mechanism involves mutations that change a single protein building block (amino acid) in the KCNE1 protein, disrupting its normal structure. This structural alteration prevents proper regulation of potassium ion flow through channels in the inner ear and cardiac muscle. The resulting loss of channel function leads to the characteristic arrhythmia and hearing loss .

The specificity of these symptoms to cardiac and auditory systems correlates with the high expression and critical functional role of KCNE1 in these tissues. Understanding these mutation-function relationships provides insight into potential therapeutic approaches for addressing channelopathies resulting from KCNE1 dysfunction.

What techniques are most effective for studying KCNE1-KCNQ1 interactions?

Multiple complementary techniques have proven effective for investigating KCNE1-KCNQ1 interactions, with the most informative approaches combining structural modeling with functional validation. Computational methods such as molecular docking with Rosetta have been successfully employed to develop models of KCNQ1-KCNE1 complexes in different conformational states .

These structural predictions are strengthened through experimental validation using techniques including:

  • Disulfide crosslinking: Identifying residue pairs capable of forming disulfide bonds when substituted with cysteines indicates proximity in the native structure. This approach has identified different crosslinking patterns in open versus closed states .

  • Site-directed mutagenesis: Systematic mutation of residues (to Cys, Trp, Asn, or Ala) across the KCNE1 transmembrane domain (TMD) provides insight into functionally important positions. The effect of mutations on voltage-dependent activation and gating kinetics reveals critical interaction sites .

  • Voltage-clamp fluorometry (VCF): This technique enables real-time monitoring of conformational changes during channel gating, providing dynamic information about KCNQ1-KCNE1 interactions.

  • Cryo-electron microscopy (cryo-EM): The recent development of high-resolution cryo-EM has allowed direct visualization of channel structures, confirming predictions from computational models .

How can researchers optimize expression systems for recombinant KCNE1 studies?

Optimizing expression systems for recombinant KCNE1 studies requires consideration of several factors to ensure proper protein folding, membrane insertion, and functional assembly with channel partners. For prokaryotic expression, Escherichia coli systems have successfully produced recombinant KCNE2 (a related protein), suggesting similar approaches may work for KCNE1 .

For eukaryotic expression, researchers typically employ:

  • Xenopus oocytes: This system allows efficient co-expression of KCNQ1 and KCNE1 for electrophysiological studies. The large cell size facilitates voltage clamp recordings, making it ideal for investigating channel kinetics and conductance properties.

  • Mammalian cell lines (HEK293, CHO): These systems provide a more native-like membrane environment and post-translational modifications. They are particularly useful for biochemical studies, fluorescence-based assays, and high-throughput screening.

To control stoichiometry in expression studies, researchers have developed linked constructs with fixed KCNQ1:KCNE1 ratios (1:4, 2:4, etc.). These constructs allow systematic investigation of how subunit composition affects channel properties .

Protein purification approaches should include appropriate detergents or amphipols to maintain the integrity of transmembrane domains. For structural studies, expression constructs may require optimization through removal of flexible regions or introduction of stabilizing mutations.

What electrophysiological protocols best characterize KCNE1-modified channel function?

Electrophysiological characterization of KCNE1-modified channels requires specialized protocols that account for the unique kinetic properties of these complexes. Several approaches have proven particularly informative:

  • Voltage step protocols: Due to the slow activation kinetics of KCNQ1-KCNE1 channels (especially with higher KCNE1 stoichiometry), extended depolarization periods (several seconds) are necessary to capture complete activation. A series of voltage steps from negative holding potentials to progressively more depolarized test potentials allows construction of conductance-voltage (G-V) relationships .

  • Envelope of tails protocol: This approach measures tail currents after depolarizing pulses of increasing duration, providing insight into activation kinetics and revealing the characteristic slow activation of KCNE1-modulated channels.

  • Single channel recordings: These provide direct measurement of conductance and open probability, revealing how KCNE1 alters channel behavior at the molecular level. Single channel analysis has demonstrated increased conductance and longer latency to first opening with increasing KCNE1 stoichiometry .

  • Temperature-dependent studies: Since KCNE1 modulation shows temperature sensitivity, recordings at physiological temperature (37°C) rather than room temperature provide more relevant functional data.

Data analysis should include determination of activation and deactivation time constants, voltage dependence of activation (V₁/₂ and slope factor), and single channel parameters (conductance, open probability, burst characteristics).

How should researchers address stoichiometric variability in KCNQ1-KCNE1 studies?

The variable stoichiometry of KCNQ1-KCNE1 complexes presents significant challenges for experimental design and data interpretation. Researchers should implement several strategies to address this variability:

  • Use of concatenated constructs: Creating linked constructs with fixed numbers of KCNQ1 and KCNE1 subunits ensures uniform stoichiometry. This approach has been validated by demonstrating that different fixed-ratio constructs recapitulate the electrophysiological properties observed with various KCNQ1:KCNE1 expression ratios .

  • Titration experiments: By systematically varying the ratio of KCNQ1 to KCNE1 in expression systems, researchers can determine how stoichiometry affects functional properties. These experiments have revealed the progressive slowing of activation and changes in G-V relationships with increasing KCNE1 incorporation .

  • Single-molecule approaches: Techniques such as total internal reflection fluorescence (TIRF) microscopy with fluorescently tagged subunits can provide direct visualization of subunit composition at the single-molecule level.

  • Mathematical modeling: Developing kinetic models that account for multiple stoichiometric states can help interpret complex electrophysiological data and predict the behavior of heterogeneous channel populations.

When analyzing data, researchers should consider that native tissues likely contain a mixture of KCNQ1-KCNE1 complexes with different stoichiometries, potentially contributing to the diverse kinetic properties observed in vivo.

What are the key considerations for correlating structural models with functional data?

Correlating structural models with functional data for KCNQ1-KCNE1 interactions requires careful consideration of several factors:

  • State-dependent interactions: KCNQ1-KCNE1 binding differs between closed and open states, necessitating separate models for each conformational state. Experimental restraints should be classified according to the channel state in which they were obtained .

  • Validation through multiple approaches: The most reliable structural insights emerge when multiple experimental techniques support the same model. For KCNQ1-KCNE1, models have been validated through comparison of predicted contacts with disulfide crosslinking results, mutational effects, and cryo-EM structures .

  • Quantitative correlation: Calculating the correlation between structural parameters (such as ΔSASA for interface residues) and functional effects of mutations provides quantitative validation of structural models. This approach has successfully identified interface positions in KCNE1 that are particularly sensitive to mutation .

  • Control calculations: The robustness of structural prediction should be assessed through control calculations, such as docking KCNE1 to experimentally determined structures (when available) or applying the same protocol to related systems with known structures (e.g., KCNQ1-KCNE3) .

  • Dynamic considerations: Static models may not capture the full range of dynamic interactions. Molecular dynamics simulations can address this limitation by exploring conformational flexibility and revealing transient interactions not evident in static models .

By integrating these considerations, researchers can develop structural models with strong predictive power for functional outcomes, as demonstrated by the successful correlation between KCNQ1-KCNE1 interface positions and the functional impact of mutations .

How can contradictory findings in KCNE1 research be reconciled?

The KCNE1 research field has encountered apparently contradictory findings, particularly regarding stoichiometry, binding sites, and functional effects. Several approaches can help reconcile these contradictions:

  • Context-dependent effects: Experimental conditions (expression system, temperature, ionic conditions) can significantly influence KCNQ1-KCNE1 interactions. Standardizing conditions or explicitly accounting for these variables may resolve apparent contradictions.

  • State-dependent interactions: Different experimental approaches may preferentially capture different conformational states. For example, some crosslinking pairs stabilize the open state while others favor the closed state . Explicitly considering state dependence can reconcile seemingly conflicting results.

  • Allosteric networks rather than direct interactions: Some energetic coupling between KCNQ1-KCNE1 residue pairs may be mediated by allosteric networks rather than direct interactions. This explains why double mutant cycle experiments sometimes suggest interactions between residues that structural models place too far apart for direct contact .

  • Heterogeneity in native systems: Native tissues likely contain channels with varying stoichiometries and potentially different regulatory factors, contributing to diverse and sometimes contradictory functional observations.

  • Refinement through iterative approaches: Combining computational modeling with experimental validation in an iterative process allows progressive refinement of models to accommodate initially contradictory findings. The development of KCNQ1-KCNE1 models through molecular docking with experimental restraints demonstrates the value of this approach .

By carefully considering these factors, researchers can develop more nuanced models that accommodate apparently contradictory findings and provide a more complete understanding of KCNE1 function.

What emerging technologies will advance KCNE1 structural studies?

Several emerging technologies hold promise for advancing structural studies of KCNE1 and its interactions with channel partners:

  • Cryo-electron microscopy (cryo-EM): Recent improvements in resolution have made it possible to visualize membrane protein complexes at near-atomic detail. The successful application of cryo-EM to KCNQ1-KCNE3 (4:4 stoichiometry) suggests similar approaches could resolve KCNQ1-KCNE1 structures in different conformational states .

  • Integrative structural biology: Combining multiple experimental techniques (NMR, X-ray crystallography, cryo-EM, crosslinking mass spectrometry) with computational modeling provides complementary structural insights. This integrative approach has successfully generated KCNQ1-KCNE1 models that satisfy experimental restraints from various techniques .

  • Advanced molecular dynamics simulations: Enhanced sampling methods and improved force fields enable more accurate simulation of membrane protein dynamics. These approaches can reveal conformational transitions and ion permeation mechanisms in KCNQ1-KCNE1 channels.

  • Single-molecule techniques: Methods such as single-molecule FRET can track conformational changes in real time, providing dynamic information about how KCNE1 modulates channel gating.

  • Artificial intelligence for structure prediction: Recent advances in protein structure prediction using deep learning (e.g., AlphaFold, RoseTTAFold) could accelerate the development of accurate KCNQ1-KCNE1 models, particularly when combined with sparse experimental constraints.

These technologies, especially when used in combination, promise to resolve remaining questions about the structural basis for KCNE1's modulation of channel function and provide targets for therapeutic intervention in related channelopathies.

How might tissue-specific modulation of KCNE1 function be therapeutically exploited?

The tissue-specific expression and function of KCNE1, particularly in cardiac and auditory systems, suggests potential for targeted therapeutic approaches:

  • Cardiac applications: KCNE1 modulation of KCNQ1 is critical for normal cardiac rhythm. Compounds that selectively modify KCNQ1-KCNE1 interactions could treat arrhythmias without affecting KCNQ1 channels in other tissues that lack KCNE1 or contain different KCNE subunits.

  • Auditory applications: Given KCNE1's role in maintaining proper ion balance for normal hearing, therapeutic approaches targeting KCNE1 function in the inner ear could potentially address certain forms of hearing loss.

  • Mutation-specific therapies: For conditions like Jervell and Lange-Nielsen syndrome caused by specific KCNE1 mutations, personalized approaches could be developed to rescue protein folding, trafficking, or function depending on the underlying molecular defect .

  • Stoichiometry-targeted interventions: Given the variable stoichiometry of KCNQ1-KCNE1 complexes and its impact on channel properties, compounds that selectively bind to complexes with specific subunit compositions could provide highly targeted modulation .

  • Allosteric modulators: Understanding the allosteric mechanisms by which KCNE1 modifies channel function opens possibilities for drugs that bind at the KCNQ1-KCNE1 interface or alter coupling between voltage-sensing and pore domains.

The development of such targeted approaches requires detailed understanding of tissue-specific expression patterns, stoichiometric variability, and the structural basis for KCNE1's modulation of channel function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.