Recombinant Human Potassium voltage-gated channel subfamily F member 1 (KCNF1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
KCNF1; Potassium voltage-gated channel subfamily F member 1; Voltage-gated potassium channel subunit Kv5.1; kH1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-494
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNF1
Target Protein Sequence
MDGSGERSLPEPGSQSSAASDDIEIVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGY DTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFKNEMDFWKVDL KFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDAAEGRWRRCQKCVWKFLEKPESSCP ARVVAVLSFLLILVSSVVMCMGTIPELQVLDAEGNRVEHPTLENVETACIGWFTLEYLLR LFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQAVQALRIMRIARI FKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQSHPETLFKSIPQS FWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLE TAAKHELELMELNSSSGGEGKTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLL TEEKHHRTRLQSCK
Uniprot No.

Target Background

Function

Putative voltage-gated potassium channel.

Database Links

HGNC: 6246

OMIM: 603787

KEGG: hsa:3754

STRING: 9606.ENSP00000295082

UniGene: Hs.23735

Protein Families
Potassium channel family, F (TC 1.A.1.2) subfamily, Kv5.1/KCNF1 sub-subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in heart, brain, liver, skeletal muscle, kidney and pancreas.

Q&A

What is KCNF1 and what is its role in cellular physiology?

KCNF1 (Potassium Voltage-Gated Channel Modifier Subfamily F Member 1) is a protein-coding gene that belongs to the voltage-gated potassium (Kv) channel family. These channels represent one of the most complex classes of voltage-gated ion channels from both functional and structural standpoints. Voltage-gated potassium channels serve diverse physiological functions including regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume regulation .

KCNF1 encodes a member of the electrically silent voltage-gated potassium channel (KvS) subfamily, which cannot form functional homotetramers on their own. Instead, these alpha-subunits contain a single pore-forming region and must combine with other subunits to form tetramers . KCNF1 is notably intronless and expressed across multiple tissues including heart, skeletal muscle, brain, kidney, and pancreas, suggesting widespread physiological importance .

To study KCNF1's physiological role, researchers typically employ electrophysiological techniques such as patch-clamp recording, combined with genetic manipulation approaches in relevant cell types or animal models. Recent evidence also suggests non-canonical functions of KCNF1, particularly in cancer contexts, which extend beyond traditional ion channel activities.

How does KCNF1 differ structurally from other potassium channel subunits?

KCNF1 belongs to the 6-transmembrane (6-TM) family of potassium channels, specifically within the voltage-gated potassium channel (Kv) subfamily. Several structural characteristics distinguish KCNF1:

  • KCNF1 contains a single pore-forming region, typical of Kv alpha-subunits

  • It belongs to the electrically silent Kv (KvS) subfamilies that cannot form functional homotetramers but must heterotetramerize with other subunits like Kv2.1 to form functional channels

  • It possesses a voltage sensor domain containing the S4 segment with positively charged residues responsible for voltage sensing

  • Unlike many other potassium channel genes, KCNF1 is intronless, which has implications for its regulation and expression

The alpha-subunits of voltage-gated potassium channels like KCNF1 combine to form tetramers, creating the functional channel structure . Structurally, KCNF1 shares features with other Kv channels, including the characteristic pore domain that forms the ion conduction pathway with the potassium selectivity filter.

For investigating these structural characteristics, researchers employ techniques such as X-ray crystallography, cryo-electron microscopy, site-directed mutagenesis, and computational modeling. Understanding these structural features is essential for elucidating KCNF1's functional properties and potentially developing targeted modulators for research and therapeutic applications.

What diseases are associated with KCNF1 dysfunction?

KCNF1 dysfunction has been associated with several pathological conditions, with particularly strong evidence emerging in cancer:

  • Non-small cell lung cancer (NSCLC):

    • KCNF1 is significantly upregulated in NSCLC and associated with poor prognosis

    • Higher KCNF1 expression correlates with shortened survival in lung cancer patients

    • After adjusting for confounding factors including gender, AJCC stage N, and smoking, high KCNF1 expression remained significantly associated with poor survival (HR = 1.85, 95% CI = 1.04–3.27, P = 0.032)

  • Neurological disorders:

    • Arts Syndrome: Listed as a disease associated with KCNF1

    • Fragile X Syndrome: Listed as a disease associated with KCNF1

The evidence for KCNF1's role in cancer is particularly compelling. Studies show that silencing KCNF1 in NSCLC cell lines reduced cell proliferation and tumor progression in mouse xenografts, re-established basement membrane integrity, and enhanced cisplatin sensitivity . These findings suggest KCNF1 as a potential therapeutic target for cancer treatment.

Research approaches to investigate disease associations typically include case-control studies comparing KCNF1 expression between diseased and healthy tissues, survival analysis to correlate expression with clinical outcomes, and functional studies in disease-relevant cell and animal models.

What techniques are commonly used to detect KCNF1 expression in tissue samples?

Detection of KCNF1 expression in tissue samples can be accomplished through various complementary techniques:

  • RNA-based methods:

    • Quantitative real-time PCR (qRT-PCR): For sensitive detection of KCNF1 mRNA with high specificity

    • RNA sequencing (RNA-seq): For comprehensive transcriptome analysis and relative expression levels

    • RNA in situ hybridization: For spatial localization of KCNF1 mRNA in tissue sections

  • Protein-based methods:

    • Western blotting: For semi-quantitative detection of KCNF1 protein

    • Immunohistochemistry (IHC): For spatial localization in tissue sections

    • Immunofluorescence: For subcellular localization and co-localization studies

When implementing these techniques, researchers should consider:

  • Antibody validation: Ensuring specificity using appropriate controls

  • Reference gene selection for qRT-PCR normalization

  • Tissue processing methods to preserve epitopes

  • Subcellular localization assessment, as KCNF1 has been observed in the nucleoplasm in certain cancer cells

Based on research findings, qRT-PCR has been successfully used to analyze KCNF1 expression in different tissues, revealing upregulation in non-small cell lung cancer and variations between different intestinal regions .

How does KCNF1 contribute to cancer progression, particularly in NSCLC?

KCNF1 plays a significant role in non-small cell lung cancer (NSCLC) progression through multiple mechanisms:

  • Regulation of cell proliferation and migration:

    • Silencing of KCNF1 in NSCLC cell lines (A549 and H23) reduces cell proliferation and migration capabilities

    • This suggests KCNF1 promotes cancer cell growth and potentially enhances metastatic potential

  • Influence on tumor progression:

    • Downregulation of KCNF1 reduces tumor progression in mouse xenograft models

    • This indicates KCNF1's role extends beyond in vitro effects to in vivo tumorigenesis

  • Basement membrane integrity:

    • NSCLC cells with silenced KCNF1 exhibit re-establishment of basement membrane integrity

    • This implies KCNF1 may contribute to invasion by disrupting tissue boundaries

  • ITGB4 regulation:

    • KCNF1 positively regulates ITGB4 (Integrin Beta 4) expression

    • ITGB4 is involved in cell adhesion, migration, and invasion processes

  • Chemosensitivity modulation:

    • KCNF1 silencing enhances cisplatin sensitivity

    • This suggests a role in drug resistance mechanisms

  • Unusual subcellular localization:

    • KCNF1 is primarily localized in the nucleoplasm in NSCLC cells, rather than at the plasma membrane

    • This nucleoplasmic localization suggests non-canonical functions beyond ion conduction

  • Prognostic significance:

    • High KCNF1 expression is associated with poor survival (HR = 1.73, 95% CI = 1.35–2.22, P = 1.2e–5)

    • After adjusting for confounding factors, the association remains significant (HR = 1.85, 95% CI = 1.04–3.27, P = 0.032)

For investigating KCNF1's role in cancer, researchers should employ RNA interference or CRISPR-Cas9 for gene silencing/knockout, complemented by overexpression studies and in vivo models to validate findings. The nucleoplasmic localization of KCNF1 in cancer cells represents a particularly intriguing direction for further research.

What is the significance of KCNF1's nucleoplasmic localization in cancer cells?

The nucleoplasmic localization of KCNF1 in cancer cells, particularly NSCLC, represents an intriguing finding with several potential implications:

  • Non-canonical functions:

    • Traditional voltage-gated potassium channels function at the plasma membrane

    • Nuclear localization suggests functions beyond ion conduction

    • Potential roles in gene regulation, chromatin organization, or nuclear signaling

  • Transcriptional regulation:

    • Nuclear-localized KCNF1 may interact with transcription factors or chromatin remodeling complexes

    • Evidence suggests it positively regulates ITGB4 expression, potentially through direct or indirect nuclear actions

  • Cancer-specific function:

    • Altered subcellular localization may represent a cancer-specific adaptation

    • Could contribute to the oncogenic properties of KCNF1 in NSCLC

To study nucleoplasmic KCNF1, researchers should consider high-resolution imaging techniques such as super-resolution microscopy, biochemical fractionation to confirm localization, protein interaction studies to identify nuclear partners, and functional domain mapping to understand the mechanisms of nuclear localization and function.

Understanding the significance of nuclear KCNF1 could reveal novel therapeutic strategies targeting its non-canonical functions in cancer cells. This represents a paradigm shift in how we conceptualize ion channel proteins, recognizing they may function beyond their classical roles at the plasma membrane.

How does KCNF1 interact with ITGB4 and what are the implications for basement membrane integrity?

The interaction between KCNF1 and ITGB4 (Integrin Beta 4) represents a critical mechanism potentially explaining KCNF1's role in cancer progression and basement membrane integrity:

  • Regulatory relationship:

    • Evidence indicates KCNF1 positively regulates ITGB4 expression

    • This may occur through transcriptional regulation, given KCNF1's nucleoplasmic localization

  • ITGB4 significance:

    • ITGB4 is a component of hemidesmosomes, structures anchoring epithelial cells to the basement membrane

    • It pairs with integrin α6 to form α6β4 integrin, a laminin receptor

    • In cancer, ITGB4 often contributes to invasion and migration

  • Basement membrane implications:

    • Silencing KCNF1 in NSCLC cells re-establishes basement membrane integrity

    • This suggests KCNF1-mediated ITGB4 regulation disrupts normal basement membrane architecture

    • Intact basement membrane typically restricts cancer cell invasion

  • Cellular phenotype effects:

    • NSCLC cells with silenced KCNF1 exhibit non-transformed phenotypes

    • This includes reduced migration and proliferation

    • These changes align with restored basement membrane integrity

To investigate this interaction, researchers should employ expression correlation analysis, chromatin immunoprecipitation assays to determine if KCNF1 affects the ITGB4 promoter, and rescue experiments to confirm ITGB4 as a critical downstream effector. This research direction has significant therapeutic implications, as targeting the KCNF1-ITGB4 axis could potentially restore basement membrane integrity and reduce cancer invasion.

What experimental designs are most appropriate for studying KCNF1 function?

Developing an experimental design to study KCNF1 function requires a systematic approach tailored to the specific research question. Based on experimental design principles and KCNF1's characteristics, researchers should consider:

  • True experimental designs:

    • Random assignment of samples/subjects to experimental and control groups

    • Control groups (vector control, non-targeting control)

    • Experimental groups (KCNF1 knockdown, overexpression, mutation)

  • Study-specific considerations:

    • Define clear research questions and hypotheses about KCNF1 function

    • Identify appropriate independent variables (KCNF1 expression levels, mutations)

    • Select relevant dependent variables (channel activity, cell proliferation, gene expression)

    • Control for confounding variables (cell type, culture conditions)

  • KCNF1-specific experimental approach:

    Research QuestionExperimental DesignControlsKey Measurements
    Ion channel functionPatch-clamp electrophysiology with heterologous expressionEmpty vector, other Kv channelsCurrent-voltage relationships, activation/inactivation kinetics
    Cancer-related functionsLoss-of-function and gain-of-function in cancer cell linesNon-targeting siRNA, empty vectorProliferation, migration, invasion, tumor growth in xenografts
    Gene regulatory roleChIP-seq, RNA-seq after KCNF1 modulationInput controls, scrambled siRNABinding sites, differential gene expression
    Protein interactionsCo-immunoprecipitation, proximity labelingIgG controls, non-relevant proteinsInteraction partners, complex formation
  • Statistical considerations:

    • A priori power analysis to determine sample size

    • Appropriate statistical tests based on data distribution

    • Multiple testing correction for large-scale experiments

    • Replication across different cell lines or models

When developing an experimental design for KCNF1 research, the process should follow these key steps: define the research question and hypotheses, identify variables, determine experimental conditions, select appropriate controls, establish protocols for data collection and analysis, conduct pilot studies, implement the experiment, analyze the data using appropriate statistical methods, and interpret the results within the context of existing knowledge about KCNF1 .

What are the considerations for designing KCNF1 knockdown experiments?

Designing effective KCNF1 knockdown experiments requires careful planning to ensure robust and interpretable results:

  • Knockdown method selection:

    • siRNA: Provides transient knockdown (3-7 days), ideal for initial screenings

    • shRNA: Enables stable knockdown via lentiviral delivery, suitable for long-term studies

    • CRISPR interference (CRISPRi): For transcriptional repression without DNA modification

  • KCNF1-specific design considerations:

    • Target sequence selection: Design multiple sequences targeting different regions

    • Off-target prediction: Use bioinformatic tools to minimize off-target effects

    • Specificity for KCNF1: Avoid regions with homology to other potassium channels

    • Intronless gene consideration: All targeting sequences must be within the coding region

  • Experimental controls:

    • Non-targeting controls: Essential for distinguishing specific from non-specific effects

    • Multiple independent siRNAs/shRNAs: Confirm phenotype across different constructs

    • Rescue experiments: Re-express siRNA-resistant KCNF1 to confirm specificity

  • Validation of knockdown:

    • mRNA level: qRT-PCR with well-designed primers

    • Protein level: Western blot with validated antibodies

    • Functional validation: Assess impact on known KCNF1 functions

  • Context-specific considerations:

    • Cancer context: Monitor proliferation, migration, invasion, drug sensitivity

    • Normal physiology: Assess ion channel function, signaling pathways

    • Nuclear function: Examine gene expression changes, particularly ITGB4

Sample experimental workflow for KCNF1 knockdown:

StageStepsCritical ConsiderationsValidation Methods
DesignSelect 3-4 target sequencesAvoid homology with other channelsIn silico prediction tools
OptimizationTitrate concentrationBalance efficacy with toxicityCell viability assays
ValidationConfirm knockdown48-72h optimal for siRNAqRT-PCR, Western blot
Phenotypic analysisPerform functional assaysMatch to research questionProliferation, migration
Mechanism studiesInvestigate downstream effectsInclude ITGB4 expressionqRT-PCR, protein analysis
Rescue experimentsRe-express siRNA-resistant KCNF1Use silent mutations in target regionRestoration of phenotype

Based on published research, KCNF1 knockdown in NSCLC cell lines has successfully demonstrated reduced cell proliferation, decreased tumor progression in xenografts, and re-establishment of basement membrane integrity .

How can CRISPR-Cas9 be optimized for KCNF1 gene editing?

Optimizing CRISPR-Cas9 for KCNF1 gene editing requires careful consideration of several factors specific to this gene and its characteristics:

  • Guide RNA (gRNA) design considerations:

    • Target selection: KCNF1 is intronless, providing fewer options for targeting non-coding regions

    • Functional domain targeting: Consider targeting specific domains based on research question

    • Off-target analysis: Perform thorough in silico prediction of potential off-target sites

    • Efficiency prediction: Use algorithms to predict guide efficiency

  • KCNF1-specific optimization strategies:

    • Multiple gRNAs: Design several gRNAs targeting different regions

    • Functional domain consideration: Target domains critical for specific functions

    • Nuclear function consideration: For studies focused on nuclear roles, target nuclear localization signals

  • Cas9 variant selection:

    • Standard SpCas9: High efficiency but larger size

    • High-fidelity variants (eSpCas9, SpCas9-HF1): Reduced off-target effects

    • Base editors: For introducing point mutations without double-strand breaks

    • Prime editors: For precise edits without donor templates

  • Validation strategies:

    • Genomic validation: PCR, sequencing, T7E1 assay

    • Expression validation: qRT-PCR, Western blot

    • Functional validation: Assess effects on proliferation, migration, gene regulation

    • Off-target analysis: Targeted sequencing of predicted off-target sites

Example target region considerations for KCNF1:

Target RegionAdvantagesConsiderationsBest For
N-terminal domainMay affect channel assemblyCould disrupt multiple functionsComplete knockout studies
Voltage sensor domainTargets specific functionMay allow some functions to remainElectrophysiological studies
Pore domainCritical for ion conductionHighly conserved, risk of off-targetsIon conduction studies
C-terminal domainMay contain regulatory elementsOften contains protein interaction sitesRegulatory function studies
Nuclear localization signalTargets nuclear functionAllows membrane functions to remainNuclear function studies in cancer

The experimental design for CRISPR-Cas9 editing of KCNF1 should include appropriate controls, multiple gRNAs to ensure successful targeting, and comprehensive validation of both on-target editing and potential off-target effects .

How should researchers approach the characterization of KCNF1-protein interactions?

Characterizing KCNF1-protein interactions requires a comprehensive approach combining multiple complementary techniques to identify, validate, and functionally assess interaction partners:

  • Initial identification strategies:

    • Immunoprecipitation-Mass Spectrometry (IP-MS): Pull down KCNF1 and identify co-precipitating proteins

    • Proximity-based labeling: BioID or APEX fusion for identifying proximal proteins

    • Yeast two-hybrid screening: Use KCNF1 domains as bait

  • Validation techniques:

    • Co-immunoprecipitation (Co-IP): Reciprocal pull-downs of KCNF1 and identified partners

    • Proximity Ligation Assay (PLA): In situ detection of protein interactions

    • FRET/BRET: Real-time interaction monitoring in living cells

  • Domain mapping strategies:

    • Truncation constructs: Generate series of domain deletions

    • Point mutations: Target conserved or predicted interaction residues

    • Peptide arrays: Identify specific binding motifs

  • Subcellular localization considerations:

    • Nuclear interactions: Consider chromatin context given KCNF1's nucleoplasmic localization

    • Membrane interactions: Optimize detergent solubilization conditions

    • Co-localization studies: Use confocal or super-resolution microscopy

  • Functional characterization:

    • Electrophysiological impact: Assess effect on channel properties

    • Cellular function: Examine effects on proliferation, migration (cancer context)

    • Gene expression: Investigate impact on transcriptional targets like ITGB4

Example workflow for KCNF1 interaction studies:

PhaseTechniquesExpected OutcomesConsiderations
DiscoveryIP-MS, BioIDCandidate interactomeFalse positives, abundance bias
ValidationCo-IP, PLAConfirmed interactionsBuffer conditions, antibody specificity
MappingTruncations, mutationsInteraction domainsProtein folding effects
Functional assessmentCell-based assaysBiological significanceOverexpression artifacts
In vivo relevanceTissue co-expressionPhysiological contextTissue-specific variations

Specific interaction partners to investigate should include heterotetramerization partners like Kv2.1, transcription factors (given nuclear localization), and components of integrin signaling pathways (based on ITGB4 regulation) .

What statistical approaches are most appropriate for analyzing KCNF1 expression data in clinical samples?

Analyzing KCNF1 expression data in clinical samples requires robust statistical approaches tailored to the specific study design, sample characteristics, and research questions:

  • Differential expression analysis:

    • Parametric tests: t-test or ANOVA for comparing groups (cancer vs. normal)

    • Non-parametric alternatives: Mann-Whitney U test or Kruskal-Wallis when normality assumptions are violated

    • Linear models: For adjusting for covariates (age, gender, treatment)

  • Survival analysis approaches:

    • Kaplan-Meier analysis: Stratify patients by KCNF1 expression levels

    • Cox proportional hazards regression:

      • Univariate analysis for KCNF1 alone

      • Multivariate analysis adjusting for clinical covariates

    Evidence from KCNF1 research in lung cancer demonstrates:

    • Univariate survival analysis: HR = 1.73, 95% CI = 1.35–2.22, P = 1.2e–5

    • Multivariate Cox regression: HR = 1.85, 95% CI = 1.04–3.27, P = 0.032 (adjusted for gender, AJCC stage N, smoking)

  • Multiple testing correction:

    • Bonferroni correction: Most stringent approach

    • Benjamini-Hochberg procedure: Controls false discovery rate

    • Particularly important for genome-wide or transcriptome-wide studies

  • Sample size and power considerations:

    • A priori power analysis: Estimate required sample size based on expected effect

    • Post hoc power analysis: Interpret negative results in context of statistical power

    • Particularly important for subgroup analyses

  • Dealing with clinical data challenges:

    • Missing data: Multiple imputation techniques or complete case analysis

    • Batch effects: ComBat or similar batch correction algorithms

    • Heterogeneous samples: Stratification by relevant clinical variables

  • Reporting and visualization:

    • Standardized reporting: REMARK guidelines for prognostic markers

    • Visualization: Kaplan-Meier curves for survival data, box plots for expression differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.