Recombinant Human Potassium voltage-gated channel subfamily G member 2 (KCNG2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Potassium Voltage-Gated Channel Subfamily G Member 2 (KCNG2)

Recombinant Human Potassium Voltage-Gated Channel Subfamily G Member 2 (KCNG2) is a protein subunit that plays a crucial role in the formation and modulation of voltage-gated potassium channels. These channels are essential for various physiological processes, including the regulation of the cardiac action potential and neuronal excitability. KCNG2 acts as a modifier subunit, influencing the electrophysiological properties of potassium channels by altering their activation thresholds and inactivation kinetics.

Structure and Function of KCNG2

KCNG2 is a γ subunit that coassembles with α subunits, such as KV2.1 (also known as KCNB1), to form heteromultimeric potassium channels. These channels are vital for the repolarization phase of the action potential in excitable cells like heart and nerve cells. The interaction between KCNG2 and KV2.1 can significantly affect the channel's electrophysiological characteristics, such as current density and activation/inactivation kinetics .

Research Findings and Implications

Recent studies have highlighted the potential role of KCNG2 in diseases such as Sick Sinus Syndrome (SSS). A deletion mutation in the KCNG2 gene has been identified as a potential disease-associated variant in a Chinese family with SSS. This mutation affects the interaction between KCNG2 and KV2.1, leading to altered channel function and potentially impacting cardiac repolarization .

Table 1: Effects of KCNG2 Deletion Variant on KV2.1 Channel Function

Channel TypeCurrent Density ChangeActivation Threshold ShiftInactivation Threshold Shift
Kv2.1BaselineBaselineBaseline
Kv2.1 + KCNG2 (Wild Type)Increased from 10 mVNegative shift of 2.4 mV inactivationNegative shift in activation
Kv2.1 + KCNG2 (Mutant)Further increased from -10 mVPositive shift in inactivationNegative shift in activation

Protein-Protein Interactions and Docking Simulations

Protein-protein docking simulations have been used to predict how mutations in KCNG2 might affect its interaction with KV2.1. These simulations suggest that changes in the structure of KCNG2 can alter its binding sites with KV2.1, potentially impacting channel function .

Expression and Regulation

KCNG2 is expressed in the human heart and plays a role in cardiac action potential repolarization. Various environmental and chemical factors can influence KCNG2 expression, including toxins like tetrachlorodibenzodioxin and aflatoxin B1, which decrease KCNG2 mRNA expression .

Table 2: Factors Affecting KCNG2 Expression

FactorEffect on KCNG2 Expression
TetrachlorodibenzodioxinDecreased expression
Aflatoxin B1Decreased methylation
Cyclosporin AIncreased methylation
Licochalcone BIncreased expression

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our standard shipping includes regular blue ice packs. For shipments with dry ice, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCNG2; KCNF2; Potassium voltage-gated channel subfamily G member 2; Cardiac potassium channel subunit; Voltage-gated potassium channel subunit Kv6.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-466
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNG2
Target Protein Sequence
MEPWPCSPGGGGGTRARHVIINVGGCRVRLAWAALARCPLARLERLRACRGHDDLLRVCD DYDVSRDEFFFDRSPCAFRAIVALLRAGKLRLLRGPCALAFRDELAYWGIDEARLERCCL RRLRRREEEAAEARAGPTERGAQGSPARALGPRGRLQRGRRRLRDVVDNPHSGLAGKLFA CVSVSFVAVTAVGLCLSTMPDIRAEEERGECSPKCRSLFVLETVCVAWFSFEFLLRSLQA ESKCAFLRAPLNIIDILALLPFYVSLLLGLAAGPGGTKLLERAGLVLRLLRALRVLYVMR LARHSLGLRSLGLTMRRCAREFGLLLLFLCVAMALFAPLVHLAERELGARRDFSSVPASY WWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHTFSRSYSELKEQQQ RAASPEPALQEDSTHSATATEDSSQGPDSAGLADDSADALWVRAGR
Uniprot No.

Target Background

Function
Potassium channel subunit that modulates channel activity. It shifts the threshold and the half-maximal activation to more negative values.
Database Links

HGNC: 6249

OMIM: 605696

KEGG: hsa:26251

STRING: 9606.ENSP00000315654

UniGene: Hs.247905

Protein Families
Potassium channel family, G (TC 1.A.1.2) subfamily, Kv6.2/KCNG2 sub-subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in heart, liver, skeletal muscle, kidney and pancreas. Detected at low levels in brain, lung and placenta.

Q&A

What is KCNG2 and what is its role in cellular physiology?

KCNG2, also known as KV6.2, is a member of the voltage-gated potassium channel subfamily G. Unlike some potassium channel subunits, KCNG2 functions as an electrically silent γ-subunit, meaning it cannot form functional homotetrameric channels by itself but instead forms heterotetramers with functional pore-forming α-subunits such as KCNB1 (KV2.1) . This interaction is physiologically significant as it alters the biophysical properties of the resulting channel complex.

In normal cellular physiology, KCNG2 acts as a modulator of potassium channel activity. When expressed with functional α-subunits, KCNG2 can suppress potassium current amplitude and modify channel kinetics, effectively serving as an inhibitor of functional KV channels . This regulatory role appears to be important in controlling membrane potential and cellular excitability in various tissues, including smooth muscle cells.

How does KCNG2 differ from other potassium channel subunits?

KCNG2 belongs to a class of regulatory potassium channel subunits distinct from the pore-forming α-subunits and the cytoplasmic β-subunits. While α-subunits like KCNB1 (KV2.1) can form functional homotetrameric channels that conduct potassium ions across the membrane, and β-subunits like KCNAB2 (KVβ2) modulate channel properties from the cytoplasmic side, KCNG2 is electrically silent . This means it cannot form functional channels on its own but must associate with α-subunits to exert its effects.

The key distinction of KCNG2 and other γ-subunits is their ability to alter the kinetics and voltage-dependence of potassium currents, often resulting in rapid inactivation and decreased steady-state current amplitude when co-expressed with α-subunits . This functional characteristic sets them apart from both the channel-forming α-subunits and the auxiliary β-subunits that have different modulatory effects.

How does KCNG2 interact with other potassium channel subunits?

KCNG2 (KV6.2) primarily interacts with KCNB1 (KV2.1) subunits to form heteromultimeric channel complexes. This interaction occurs at the protein level, with KCNG2 integrating into the tetrameric channel structure alongside the pore-forming α-subunits . The resulting heterotetramer exhibits distinct electrophysiological properties compared to homomeric KCNB1 channels.

What electrophysiological effects result from KCNG2 co-expression with α-subunits?

When KCNG2 is co-expressed with functional α-subunits like KCNB1 (KV2.1), several significant electrophysiological changes occur in the resulting channel complex. The most notable effects include:

  • Decreased current amplitude compared to homomeric KCNB1 channels

  • Altered current kinetics, particularly affecting activation and inactivation rates

  • Shifted conductance-voltage relationships

  • Enhanced rate of current inactivation

Research has demonstrated that potassium currents generated by KCNB1 and KCNG2 heterotetramers are smaller than those generated by KCNB1 homotetramers . This suggests that KCNG2 functions as a suppressor of potassium channel activity. The association of KCNG2 with KCNB1 results in delayed rectifier potassium currents whose kinetics and conductance-voltage relationship differ significantly from those mediated by homomultimeric KCNB1 channels . These alterations in channel properties can have profound effects on cellular excitability and membrane potential dynamics.

How is KCNG2 expression regulated by bone morphogenetic proteins?

Bone morphogenetic protein-2 (BMP-2) has been shown to dramatically downregulate KCNG2 expression in human pulmonary artery smooth muscle cells (PASMCs). When PASMCs were treated with BMP-2 (100 nM for 18-24 hours), KCNG2 mRNA expression was reduced by more than 10-fold (11.17-fold lower, P < 0.0001) compared to control cells . This represents one of the most significant changes among all potassium channel subunits examined in response to BMP-2 treatment.

The molecular mechanisms underlying this significant downregulation may involve the BMP signaling pathway, which typically functions through Smad transcription factors. Additionally, research suggests that attenuation of c-Myc expression by BMP-2 may be involved in BMP-2-mediated regulation of potassium channel expression, including the dramatic downregulation of KCNG2 . This regulatory pathway appears to be part of BMP-2's broader effects on cell proliferation, apoptosis, and potassium channel activity in PASMCs.

What is the relationship between KCNG2 regulation and cellular apoptosis?

BMP-2 is known to induce significant cell volume decrease (apoptotic volume decrease) and apoptosis in PASMCs . The concurrent downregulation of KCNG2 and upregulation of several functional KV channel α-subunits by BMP-2 creates a cellular environment favoring increased potassium efflux. Since potassium channel activity plays an important role in controlling apoptosis and proliferation in PASMCs, the dramatic reduction in KCNG2 expression appears to be part of the mechanism by which BMP-2 promotes apoptotic processes in these cells .

What experimental techniques are most effective for studying KCNG2 function?

Several complementary experimental techniques are essential for comprehensive investigation of KCNG2 function:

  • Patch-clamp electrophysiology: Whole-cell recordings provide direct measurement of potassium currents (IK(V)) in cells expressing KCNG2 with other channel subunits. This technique allows researchers to analyze current amplitude, activation/inactivation kinetics, and voltage dependence . Protocols typically involve step depolarizations from holding potentials around -70 mV to test potentials ranging from -60 to +80 mV.

  • Quantitative real-time PCR (qRT-PCR): This technique enables precise quantification of KCNG2 mRNA expression levels under various experimental conditions. Studies have used this approach to demonstrate the dramatic downregulation of KCNG2 in response to BMP-2 treatment .

  • Co-expression systems: Heterologous expression of KCNG2 with α-subunits in expression systems like Xenopus oocytes or HEK293 cells allows for controlled study of subunit interactions and resulting channel properties.

  • Gene silencing/overexpression: siRNA knockdown or overexpression of KCNG2 helps establish causal relationships between KCNG2 expression levels and cellular functions or potassium current properties.

Each of these techniques provides unique insights into KCNG2 function, and combining multiple approaches yields the most comprehensive understanding of this regulatory subunit's role in channel function and cellular physiology.

How can computational approaches be applied to study KCNG2 regulation?

Advanced computational approaches offer powerful tools for studying KCNG2 regulation and function:

  • Granger causality methods: Tools like GrID-Net enable detection of asynchronous interactions between gene regulatory elements along single-cell trajectories . Such approaches could be applied to investigate the temporal regulation of KCNG2 in relation to other genes during cellular processes like differentiation or response to stimuli.

  • Multimodal data integration: Methodologies that integrate RNA-seq, ATAC-seq, and other genomic data can identify regulatory elements affecting KCNG2 expression. For instance, constructing directed acyclic graphs (DAGs) of cell states from k-nearest neighbor graphs allows researchers to track gene expression changes over pseudotime .

  • Three-dimensional chromatin contact analysis: Computational methods that analyze Hi-C data can identify spatial interactions between KCNG2 promoters and distant regulatory elements, providing insights into the chromatin-level regulation of KCNG2 .

  • Mathematical modeling of channel kinetics: Computational models that incorporate KCNG2's effects on channel properties can predict how changes in KCNG2 expression might affect cellular electrophysiology and downstream processes like apoptosis.

These computational approaches complement experimental techniques and are particularly valuable for studying complex regulatory networks and dynamic processes that are difficult to capture with experimental methods alone.

What is the potential role of KCNG2 in pulmonary vascular disease?

KCNG2 may play a significant role in pulmonary vascular diseases, particularly pulmonary hypertension, through its regulation of potassium channel function in pulmonary artery smooth muscle cells (PASMCs). Research has established that dysfunctional BMP signaling and downregulated KV channels are involved in pulmonary vascular medial hypertrophy associated with pulmonary hypertension . The relationship between KCNG2, BMP signaling, and potassium channel activity provides insight into potential disease mechanisms.

BMP-2 normally inhibits proliferation and induces apoptosis in normal human PASMCs, effects that are partly mediated through regulation of potassium channel activity . The dramatic downregulation of KCNG2 by BMP-2 appears to contribute to increased whole-cell potassium currents, which may promote apoptosis and inhibit proliferation. In pulmonary hypertension, where BMP signaling is often disrupted, altered regulation of KCNG2 could potentially contribute to the enhanced PASMC proliferation and resistance to apoptosis that characterizes the disease.

Understanding how KCNG2 expression and function change in pulmonary vascular disease could provide new insights into disease pathogenesis and potentially identify novel therapeutic targets for conditions like pulmonary hypertension.

How does KCNG2 expression compare with other potassium channel subunits under BMP-2 treatment?

BMP-2 treatment causes diverse changes in the expression of various potassium channel subunits, with KCNG2 showing one of the most dramatic responses. The table below summarizes the fold changes in mRNA expression of different potassium channel subunits in human PASMCs treated with BMP-2 (100 nM for 18-24 hours) compared to control cells:

SubunitCommon NameFold ChangeP-valueDirection
KCNG2KV6.211.17<0.0001Decrease
KCNV2KV11.122.660.0003Decrease
KCNAB1KVβ1.1>2<0.001Decrease
KCNA2KV1.2>2<0.01Decrease
KCNAB3KVβ3<2<0.05Decrease
KCNB2KV2.2<2<0.05Decrease
KCNA7KV1.7>4<0.01Increase
KCNS3KV9.3>4<0.01Increase
KCNA5KV1.5>2<0.01Increase
KCNA10KV1.10>2<0.01Increase
KCNC3KV3.3>2<0.01Increase
KCNC4KV3.4>2<0.001Increase
KCNF1KV5.1>2<0.01Increase
KCNS1KV9.1>2<0.001Increase
KCNG3KV6.1>2<0.01Increase

This comparative analysis reveals that KCNG2 and KCNV2, both electrically silent γ-subunits that form heterotetramers with functional KV channel α-subunits, show the most significant downregulation among all potassium channel subunits examined . This pattern suggests a coordinated regulatory response that may collectively enhance potassium channel activity by both upregulating functional α-subunits and downregulating inhibitory γ-subunits.

What are the electrophysiological differences between channels with and without KCNG2?

The incorporation of KCNG2 into potassium channel complexes significantly alters their electrophysiological properties. Research comparing KCNB1 (KV2.1) homotetrameric channels with KCNB1-KCNG2 heterotetrameric channels has revealed several key differences:

  • Current amplitude: Potassium currents generated by KCNB1-KCNG2 heterotetramers are smaller than those generated by KCNB1 homotetramers . This reduction in current amplitude suggests that KCNG2 exerts an inhibitory effect on channel conductance.

  • Activation kinetics: Channels containing KCNG2 show altered activation kinetics compared to homomeric KCNB1 channels. The time course of channel opening in response to membrane depolarization is modified when KCNG2 is present .

  • Inactivation properties: The presence of KCNG2 in channel complexes tends to enhance inactivation, leading to more rapid current decay during sustained depolarization .

  • Voltage-dependence: The conductance-voltage relationship of channels containing KCNG2 differs from that of homomeric KCNB1 channels, potentially shifting the voltage range over which the channels are activated .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.