Recombinant Human Potassium voltage-gated channel subfamily G member 4 (KCNG4)

Shipped with Ice Packs
In Stock

Description

Functional Role in Ion Channel Modulation

KCNG4 is a "silent" subunit that cannot form functional channels alone but modulates Kv2.1 (KCNB1) activity by altering its biophysical properties :

  • Trafficking Dependency: Requires co-expression with Kv2.1 for plasma membrane localization .

  • Voltage Sensitivity: Shifts the voltage dependence of Kv2.1 inactivation to hyperpolarized potentials, reducing neuronal excitability .

  • Expression: Predominantly in brain neurons and peripheral sensory neurons (e.g., uterine nociceptors) .

Pain Modulation

  • Labor Pain: The KCNG4 variant KV6.4-Met419 is linked to reduced labor pain. This variant fails to traffic to the membrane, lowering nociceptor excitability by preventing Kv2.1 modulation .

  • Migraine: The KV6.4-L360P variant abolishes Kv2.1 currents, increasing trigeminal neuron excitability and migraine susceptibility .

Gastrointestinal Motility

  • Hirschsprung’s Disease (HSCR): KCNG4 expression is significantly downregulated in HSCR colon tissues, impairing interstitial cells of Cajal function and colonic motility .

Pharmacological Interactions

  • Chemical Sensitivity: KCNG4 expression in rats is altered by toxins (e.g., polychlorinated biphenyls) and hormones (e.g., testosterone), suggesting regulatory roles in detoxification and hormonal signaling .

Comparative Research Studies

Study FocusKey FindingsCitations
Kv6.4-Met419 in LaborReduced nociceptor excitability due to cytoplasmic retention of Kv6.4
Kv6.4-L360P in MigraineNear-complete loss of Kv2.1 currents in trigeminal neurons
HSCR PathogenesisKCNG4 downregulation correlates with impaired colonic motility
Structural InsightsAlphafold modeling confirms S4–S5 linker disruption by L360P mutation

Applications in Research

  • Drug Development: Used to study Kv2.1 modulation in pain disorders and neurological conditions .

  • Protein Interaction Studies: Co-expressed with Kv2.1 in Xenopus oocytes or mammalian cells to analyze channel kinetics .

  • Disease Modeling: CRISPR-edited cell lines explore KCNG4 variants’ roles in migraines and visceral pain .

Challenges and Future Directions

  • Expression Variability: Recombinant KCNG4 requires optimized conditions to prevent aggregation .

  • Therapeutic Targeting: Developing small molecules to restore Kv2.1/Kv6.4 interactions could treat pain or hyperexcitability disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
KCNG4; KCNG3; Potassium voltage-gated channel subfamily G member 4; Voltage-gated potassium channel subunit Kv6.4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-519
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNG4
Target Protein Sequence
MPMPSRDGGLHPRHHHYGSHSPWSQLLSSPMETPSIKGLYYRRVRKVGALDASPVDLKKE ILINVGGRRYLLPWSTLDRFPLSRLSKLRLCRSYEEIVQLCDDYDEDSQEFFFDRSPSAF GVIVSFLAAGKLVLLQEMCALSFQEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHR EDVLRQQRETRRPASHSSRWGLCMNRLREMVENPQSGLPGKVFACLSILFVATTAVSLCV STMPDLRAEEDQGECSRKCYYIFIVETICVAWFSLEFCLRFVQAQDKCQFFQGPLNIIDI LAISPYYVSLAVSEEPPEDGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTL GLTVRRCTREFGLLLLFLAVAITLFSPLVYVAEKESGRVLEFTSIPASYWWAIISMTTVG YGDMVPRSVPGQMVALSSILSGILIMAFPATSIFHTFSHSYLELKKEQEQLQARLRHLQN TGPASECELLDPHVASEHELMNDVNDLILEGPALPIMHM
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It can form functional heterotetrameric channels in combination with KCNB1, modulating the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1.
Gene References Into Functions
  1. KCNE5 subunits potentially influence Kv2.1 homotetramers and Kv2.1/Kv6.4 heterotetramers in vivo, leading to more tissue-specific fine-tuning mechanisms. PMID: 26242757
  2. KvS subunits modify the pharmacological response of Kv2 subunits when assembled in heterotetramers. This demonstrates the potential of KvS subunits to contribute unique properties to heterotetramers, as observed with 4-AP on Kv2.1/Kv6.4 channels. PMID: 26505474
  3. Obligatory heterotetramerization of three previously uncharacterized Kv channel subunits identified in the human genome: (Kv6.3)(Kv10.1) (Kv11.1) PMID: 12060745
  4. This study suggests that the silent behavior of Kv6.3 is primarily attributed to the C-terminal part of its sixth transmembrane domain, which causes ER retention of the subunit. PMID: 16096342
  5. Mutation of histidine 105 in the T1 domain of the potassium channel Kv2.1 disrupts heteromerization with Kv6.3 and Kv6.4. PMID: 19074135

Show More

Hide All

Database Links

HGNC: 19697

OMIM: 607603

KEGG: hsa:93107

STRING: 9606.ENSP00000312129

UniGene: Hs.335877

Protein Families
Potassium channel family, G (TC 1.A.1.2) subfamily, Kv6.4/KCNG4 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in brain, and at lower levels in liver, small intestine and colon.

Q&A

What is the basic structure and function of KCNG4?

KCNG4 encodes the voltage-gated potassium channel subunit Kv6.4, which belongs to the electrically silent group of Kv subunits. Unlike typical potassium channels, Kv6.4 cannot form functional homotetramers at the plasma membrane independently. Instead, it acts as a modulator by heterotetramerizing with Kv2.1 in a 1:3 stoichiometry, creating channels with altered biophysical properties . Structurally, Kv6.4 features six transmembrane domains (S1-S6) with the critical pore-forming region located in the S5-S6 linker, containing the highly conserved K+ selectivity filter consensus sequence (TVGYG) .

How is KCNG4 expressed in neuronal tissues?

In mouse models, Kcng4 mRNA is detected in approximately 40% of retrograde-labeled uterine sensory neurons . This expression shows pathway-specific distributions: 43% in thoracolumbar (T12-L2) and 24% in lumbosacral (L5-S2) uterine sensory neurons . Importantly, virtually all neurons expressing Kcng4 also co-express Kcnb1 (encoding Kv2.1), suggesting obligate co-expression in these neuronal populations . Additionally, over 90% of Kcng4-positive neurons express nociceptor markers Trpv1 and Scn10a, indicating Kv6.4's predominant expression within nociceptive neuronal populations .

What techniques are most effective for detecting KCNG4 expression in tissue samples?

For detecting KCNG4 expression in tissue samples, researchers have successfully employed:

  • Single-cell RT-PCR following retrograde labeling of uterine sensory neurons with Fast Blue

  • Exome sequencing with confirmation via Sanger sequencing for genetic variant identification

  • Co-expression analysis to identify neurons expressing both Kcng4 and other genes of interest (e.g., Kcnb1, Trpv1, Scn10a)

These approaches allow for precise identification of KCNG4-expressing cells and detailed analysis of co-expression patterns with other functionally relevant genes.

What significant KCNG4 genetic variants have been identified in human populations?

The most significant KCNG4 variant identified is SNP rs140124801, which introduces a missense change p.Val419Met in the Kv6.4 protein . This variant alters a valine residue in the highly conserved K+ selectivity filter consensus sequence . Multiple studies have demonstrated that this rare allele is over-represented in women who did not require analgesics during labor, appearing in heterozygotes at a rate significantly higher than expected (observed: 4-6 cases vs. expected: 0.7-1.57 cases, p=0.0096-0.0288) . This genetic finding represents a remarkable case where a rare genetic variant provides insight into physiological pain mechanisms.

How does the p.Val419Met variant affect Kv6.4 functionality at the molecular level?

The p.Val419Met variant (Kv6.4-Met419) exhibits distinct functional aberrations compared to wild-type Kv6.4:

  • Trafficking defect: Kv6.4-Met419 fails to properly traffic to the plasma membrane, remaining retained in the cytoplasm

  • Dominant-negative effect: The variant acts in a dominant-negative manner, preventing normal modulation of Kv2.1 channel activity

  • Altered electrophysiology: Neurons overexpressing Kv6.4-Met419 show a more depolarized voltage dependence of inactivation for Kv2.1 compared to those expressing wild-type Kv6.4

  • Increased action potential threshold: Kv6.4-Met419 overexpression results in hypoexcitable sensory neurons with higher action potential thresholds

These molecular mechanisms explain how this variant can significantly alter pain perception, particularly during labor.

What methodological approaches can differentiate wild-type Kv6.4 from the Met419 variant in functional studies?

To differentiate wild-type Kv6.4 from the Met419 variant in functional studies, researchers should implement:

  • Subcellular localization studies using tagged constructs (e.g., HA-tagged Kv6.4) to visualize trafficking patterns

  • Co-expression with fluorescent-tagged Kv2.1 to assess heterotetramer formation and membrane localization

  • Whole-cell patch-clamp recordings to compare the voltage-dependent properties of Kv2.1 currents when co-expressed with either wild-type Kv6.4 or Kv6.4-Met419

  • Analysis of voltage dependence of inactivation, particularly focusing on the shifts in inactivation curves between wild-type and variant channels

  • Action potential threshold measurements in neurons expressing each variant to assess functional consequences on excitability

How does Kv6.4 modulate neuronal excitability in pain pathways?

Kv6.4 modulates neuronal excitability primarily through its interaction with Kv2.1 channels, which affects the voltage dependence of channel inactivation . In wild-type conditions, Kv6.4 forms heteromeric channels with Kv2.1, altering their biophysical properties compared to homomeric Kv2.1 channels . This modulation is particularly significant in uterine nociceptors, where Kv6.4 is expressed in neurons that also express the pain-related ion channels Trpv1 and Scn10a .

When the Kv6.4-Met419 variant is present, it cannot properly modulate Kv2.1 channel activity, resulting in a more depolarized voltage dependence of inactivation . This alteration leads to hypoexcitable sensory neurons with a higher action potential threshold . Consequently, these neurons require stronger stimuli to generate action potentials, effectively raising the pain threshold—a mechanism that explains the reduced labor pain experienced by carriers of this variant.

What experimental protocols best capture the Kv6.4-Kv2.1 interaction dynamics?

Optimal experimental protocols for examining Kv6.4-Kv2.1 interactions include:

  • Heterologous co-expression systems: Utilizing HEK293 cells that lack endogenous Kv6.4 expression to co-express Kv6.4 (wild-type or Met419) with Kv2.1

  • Fluorescent tagging: Employing constructs with reporters like mCherry for Kv6.4 and nuclear GFP for Kv2.1 to visualize expression patterns

  • Voltage-clamp protocols: Implementing specific voltage steps to assess activation, steady-state inactivation, and recovery from inactivation

  • Pharmacological isolation: Using Stromatoxin-1 to isolate and specifically study Kv2.1-mediated currents when examining the effects of Kv6.4

  • Computational modeling: Fitting experimental data to Boltzmann functions to quantify shifts in voltage-dependent parameters

How do quantitative sensory testing results correlate with KCNG4 genotypes?

In case-controlled studies, individuals carrying the rare KCNG4 allele (rs140124801) demonstrated significantly increased cuff pressure pain thresholds compared to non-carriers (p=0.0029, uncorrected; p=0.009, Sidak's correction) . This experimental finding correlates with the clinical observation that these individuals did not require analgesics during labor.

Interestingly, the experimental cuff pressure pain threshold remained significantly increased in the test cohort even when the rare allele carriers were excluded from analysis (p=0.0029, uncorrected; p=0.009, Sidak's correction) . This suggests that while the KCNG4 variant strongly influences pain perception, other genetic or physiological factors may also contribute to increased pain thresholds in women who don't require analgesia during labor.

What cellular models are most appropriate for studying recombinant KCNG4?

For studying recombinant KCNG4, the following cellular models have proven effective:

  • HEK293 cells: Particularly suitable as they lack significant endogenous Kv6.4 expression, providing a clean background for heterologous expression studies

  • Primary sensory neurons: Dorsal root ganglion neurons can be used for overexpression studies to examine effects on neuronal excitability in a more physiologically relevant context

  • Co-expression systems: Models that allow for controlled expression of both Kv6.4 and Kv2.1, preferably with fluorescent tags to monitor expression levels and subcellular localization

When designing experiments with these models, consider incorporating appropriate controls for expression levels and functionality verification through both imaging and electrophysiological approaches.

What are the most informative electrophysiological protocols for characterizing Kv6.4 function?

The most informative electrophysiological protocols for characterizing Kv6.4 function include:

  • Voltage-dependent activation: Applying depolarizing voltage steps from a hyperpolarized holding potential to assess channel activation properties

  • Steady-state inactivation: Using a two-pulse protocol with varying pre-pulse potentials followed by a test pulse to determine the voltage dependence of inactivation

  • Recovery from inactivation: Employing paired-pulse protocols with varying interpulse intervals to assess the time course of recovery

  • Action potential threshold determination: In neuronal preparations, measuring the minimum current required to elicit an action potential in cells expressing wild-type versus variant Kv6.4

  • Pharmacological manipulation: Applying K+ channel blockers like Stromatoxin-1 to isolate and characterize Kv2.1-mediated currents

How can researchers effectively isolate and identify uterine sensory neurons expressing KCNG4?

For effective isolation and identification of uterine sensory neurons expressing KCNG4, researchers should implement this multi-step approach:

  • Retrograde labeling: Inject Fast Blue into the uterine horn to label sensory neurons innervating this tissue

  • Isolation of labeled neurons: Harvest dorsal root ganglia from thoracolumbar (T12-L2) and lumbosacral (L5-S2) regions, dissociate the cells, and isolate labeled neurons

  • Single-cell analysis: Perform single-cell RT-PCR to detect Kcng4 mRNA along with other genes of interest (Kcnb1, Trpv1, Scn10a)

  • Pathway-specific analysis: Compare expression patterns between thoracolumbar and lumbosacral pathways to identify differential expression

This approach enables precise identification of KCNG4-expressing neurons and comprehensive characterization of their molecular profile, including co-expression with functionally relevant genes.

How might understanding KCNG4 function inform novel analgesic development?

Understanding KCNG4 function offers promising avenues for novel analgesic development, particularly for labor pain management. Research indicates that systemic delivery of a Kv6.4 antagonist could potentially serve as a useful labor analgesic without the adverse effects associated with currently available local anesthetics, even when administered via the epidural route .

Several specific strategies for drug development emerge from current research:

  • Targeting Kv6.4-Kv2.1 interactions: Developing compounds that specifically modulate the ability of Kv6.4 to alter Kv2.1 function

  • Mimicking Kv6.4-Met419 effects: Creating molecules that induce a state similar to that caused by the Kv6.4-Met419 variant, leading to hypoexcitable nociceptors

  • Tissue-specific targeting: Designing drugs with preferential activity in uterine sensory neurons to minimize off-target effects

  • Modulating trafficking: Developing compounds that affect Kv6.4 trafficking to the plasma membrane

What experimental approaches can determine if KCNG4 modulation affects other sensory modalities?

To determine if KCNG4 modulation affects other sensory modalities beyond labor pain, researchers should consider:

  • Comprehensive quantitative sensory testing: Assessing multiple pain modalities (heat, cold, mechanical, pressure) in individuals with different KCNG4 genotypes

  • Pathway-specific analyses: Investigating Kcng4 expression in sensory neurons innervating different tissues beyond the uterus

  • Behavioral testing in animal models: Evaluating responses to various sensory stimuli in animals with altered Kcng4 expression or function

  • Cross-modal sensory integration studies: Examining how KCNG4 modulation might affect integration of different sensory inputs at spinal or supraspinal levels

Current data shows that carriers of the KCNG4 variant had significantly higher cuff pressure pain thresholds than non-carriers, suggesting potential effects on deep somatic pressure pain beyond labor-specific contexts .

What are the key considerations for developing genetic screening tools for KCNG4 variants in clinical pain studies?

When developing genetic screening tools for KCNG4 variants in clinical pain studies, researchers should consider:

  • Target population selection: Focus on populations where pain modulation is clinically significant, such as nulliparous parturients

  • Screening methodology: Employ targeted sequencing approaches for the specific region containing rs140124801 rather than full exome sequencing for efficiency

  • Statistical power considerations: Account for the rarity of variants like rs140124801 (expected frequency approximately 1-2% in heterozygotes) when determining sample sizes

  • Phenotypic characterization: Include comprehensive pain threshold testing and detailed clinical pain assessments to correlate with genotypic findings

  • Ethical implications: Address ethical questions around genetic testing for pain sensitivity, particularly in obstetric settings

A practical screening approach would involve PCR amplification of the region containing rs140124801 followed by Sanger sequencing or specific genotyping assays, with appropriate controls and statistical analyses accounting for the variant's rarity.

How might KCNG4 interact with other pain-related ion channels and receptors?

Research suggests complex interactions between KCNG4 and other pain-related channels:

Future research should investigate whether Kv6.4 physically or functionally interacts with these other channels, potentially through proteomic approaches or simultaneous electrophysiological recordings of multiple channel types.

What methodological challenges exist in studying silent potassium channel subunits like Kv6.4?

Studying silent potassium channel subunits like Kv6.4 presents several methodological challenges:

  • Obligate heteromerization: Kv6.4 requires co-expression with Kv2.1 for functional expression, complicating the isolation of Kv6.4-specific effects

  • Variable stoichiometry: Controlling the exact ratio of Kv6.4 to Kv2.1 in expression systems is difficult but critical for reproducible results

  • Trafficking dynamics: Distinguishing between trafficking defects and functional alterations requires sophisticated imaging and electrophysiological approaches

  • Endogenous expression: Accounting for endogenous Kv2.1 expression in neuronal preparations when studying overexpressed Kv6.4

  • Pharmacological limitations: Lack of Kv6.4-specific pharmacological tools hampers selective modulation

Researchers can address these challenges through careful experimental design, including the use of tagged constructs, controlled expression systems, and comprehensive electrophysiological protocols.

How can computational modeling enhance our understanding of Kv6.4-Kv2.1 interactions?

Computational modeling can significantly enhance understanding of Kv6.4-Kv2.1 interactions through:

  • Structure-function predictions: Modeling the molecular consequences of the Val419Met substitution on potassium channel selectivity and gating

  • Heterotetramer dynamics: Simulating how different stoichiometries of Kv6.4:Kv2.1 affect channel function

  • Neuronal excitability models: Incorporating Kv6.4-modulated currents into models of sensory neuron excitability to predict effects on action potential generation

  • Population-level simulations: Modeling the epidemiological impact of rare variants like rs140124801 on population-wide pain perception variability

  • Drug interaction simulations: Virtual screening of compounds that might specifically target Kv6.4-Kv2.1 interactions

By integrating experimental data with computational approaches, researchers can generate testable hypotheses about how Kv6.4 modulates neuronal function and pain perception at molecular, cellular, and systems levels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.