Recombinant Human Potassium voltage-gated channel subfamily S member 1 (KCNS1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCNS1; Potassium voltage-gated channel subfamily S member 1; Delayed-rectifier K(+ channel alpha subunit 1; Voltage-gated potassium channel subunit Kv9.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-526
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNS1
Target Protein Sequence
MLMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDTGIRWRRSDEALRVNVGGVR RQLSARALARFPGTRLGRLQAAASEEQARRLCDDYDEAAREFYFDRHPGFFLSLLHFYRT GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPC PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGKEFGHLGKVVQVFRLMRIFRVLKLARHST GLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTVSMT TVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHQ EFEDLLSSIDGVSEASLETSRETSQEGQSADLESQAPSEPPHPQMY
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It can form functional heterotetrameric channels with KCNB1 and KCNB2, modulating the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1 and KCNB2.
Gene References Into Functions
  1. For KCNS1 rs4499491, individuals homozygous for the rare A allele (CC+ CA versus AA) exhibited a 3.0-fold increase in the odds of reporting preoperative breast pain. PMID: 24392765
  2. Moderate statistical evidence supported interactions between shoulder pain phenotypes and KCNS1, depressive symptoms, pain catastrophizing, or kinesiophobia. PMID: 24373571
  3. Several haplotypes of population-specific tagSNPs correlated with pain intensity in black southern African populations with HIV-associated sensory neuropathy. PMID: 23314412
  4. This study identified the KCNS1 allele rs734784 as one of the first prognostic indicators of chronic pain risk. PMID: 20724292
Database Links

HGNC: 6300

OMIM: 602905

KEGG: hsa:3787

STRING: 9606.ENSP00000307694

UniGene: Hs.117780

Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.1/KCNS1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in all tissues tested with the exception of skeletal muscle. Highly expressed in adult and fetal brain, fetal kidney and lung, and adult prostate and testis.

Q&A

What is KCNS1 and how does it function within the potassium channel family?

KCNS1 belongs to the voltage-gated potassium channel family, which plays critical roles in regulating neuronal excitability. While specific functions of KCNS1 are still being elucidated, we can infer its role based on related potassium channels. Similar to other K+ channels, KCNS1 likely contributes to the regulation of membrane potential and nerve signaling by mediating transmembrane potassium transport .

Unlike some other potassium channels that can form functional homotetrameric channels independently, KCNS1 is believed to function primarily as a modulatory subunit that assembles with other Kv channel alpha subunits to form heteromeric channels with modified properties. This is similar to how KCNE1 modulates KCNQ1 channels to generate distinctive electrical properties .

What experimental models are used to study KCNS1 function?

When investigating KCNS1 function, researchers typically employ multiple complementary approaches:

  • Animal models: Mouse models of temporal lobe epilepsy have proven valuable for studying KCNS1 expression changes in pathological conditions. These models allow for the examination of both transcriptional and translational regulation of KCNS1 in disease states .

  • Heterologous expression systems: Cell lines (typically HEK293 or CHO cells) transfected with KCNS1 alone or in combination with other channel subunits can be used to study channel biophysics using patch-clamp electrophysiology.

  • Primary neuronal cultures: These provide a more physiologically relevant environment for studying KCNS1 function in neurons, although they present technical challenges for isolating KCNS1-specific currents.

Researchers should carefully consider the advantages and limitations of each model system when designing experiments to address specific questions about KCNS1 function.

How can KCNS1 expression be accurately measured in tissue samples?

Accurate measurement of KCNS1 expression requires multiple complementary approaches:

  • qRT-PCR: This technique allows for the quantification of KCNS1 mRNA expression levels. When designing primers, researchers should ensure specificity by targeting unique regions of KCNS1 not shared with other potassium channel genes.

  • Western blotting: For protein-level detection, validated antibodies against KCNS1 are essential. When interpreting Western blot results, researchers should include appropriate positive and negative controls to confirm antibody specificity .

  • Immunohistochemistry/immunofluorescence: These techniques allow for visualization of KCNS1 distribution in tissues, providing valuable information about subcellular localization.

  • RNA-Seq: For more comprehensive analysis, RNA-Seq can detect changes in KCNS1 expression alongside other genes, enabling identification of coordinated expression patterns with other potassium channels or regulatory factors .

How does KCNS1 contribute to neuronal excitability in epilepsy?

Current evidence suggests that KCNS1 plays an important role in regulating neuronal excitability and is dysregulated in epilepsy. Research has shown that KCNS1 expression is downregulated in brain tissue from epilepsy models, suggesting that reduced KCNS1 function may contribute to the hyperexcitability characteristic of epileptic tissue .

The precise mechanism by which KCNS1 modulates neuronal excitability likely involves:

  • Modulation of action potential properties: By influencing voltage-dependent activation and inactivation of potassium currents, similar to how other potassium channel modulatory subunits function .

  • Influence on neuronal firing patterns: Changes in KCNS1 expression may alter the threshold for neuronal firing and affect repetitive firing properties.

  • Network effects: KCNS1 downregulation may disrupt the balance between excitatory and inhibitory transmission in neural circuits.

To fully understand these mechanisms, researchers should employ a combination of electrophysiological recordings, calcium imaging, and computational modeling approaches.

What molecular techniques are most effective for studying KCNS1 interactions with other channel subunits?

Understanding KCNS1 interactions with other channel subunits requires sophisticated molecular approaches:

  • Co-immunoprecipitation: To identify protein-protein interactions between KCNS1 and other channel subunits. This technique can reveal the composition of channel complexes containing KCNS1.

  • FRET/BRET: These techniques can detect close associations between fluorescently tagged proteins, providing information about KCNS1 interactions with other channel subunits in living cells.

  • Bimolecular fluorescence complementation (BiFC): This allows visualization of protein interactions in living cells by reconstituting a fluorescent protein when two fragments are brought together by interacting proteins.

  • Protein interface mapping: Similar to studies with KCNE1 and Kv7.1, researchers can use mutagenesis approaches to identify key residues involved in interactions between KCNS1 and its partner subunits .

  • Cryo-EM: This emerging technique could potentially reveal the structural basis of KCNS1 interactions with other channel subunits at near-atomic resolution.

How does KCNS1 function compare to other voltage-gated potassium channel modulatory subunits?

KCNS1 shares functional similarities with other modulatory potassium channel subunits, but also has unique properties:

  • Modulatory effects: Like KCNE1, which remodels the voltage sensor of Kv7.1 to modulate channel function, KCNS1 likely alters the biophysical properties of channels formed with other Kv alpha subunits .

  • Tissue distribution: While many potassium channels are widely expressed throughout the body, KCNS1 shows enriched expression in neural tissues, suggesting tissue-specific functions.

  • Disease associations: Unlike KCNE1, which is associated with cardiac arrhythmias and hearing loss when mutated , KCNS1 has been implicated in neurological disorders such as epilepsy .

Comparative studies using electrophysiological approaches to characterize the biophysical effects of different modulatory subunits on common alpha subunits would provide valuable insights into the unique contributions of KCNS1.

What are the key controls necessary for studying recombinant KCNS1 in expression systems?

When designing experiments with recombinant KCNS1:

  • Expression verification: Confirm KCNS1 expression using Western blotting or immunofluorescence before functional studies.

  • Appropriate partner subunits: Since KCNS1 likely functions as a modulatory subunit, co-expression with relevant alpha subunits is essential for functional studies.

  • Negative controls: Include cells transfected with empty vector or expressing only the alpha subunits without KCNS1.

  • Positive controls: Include well-characterized channel complexes (e.g., KCNA1 or KCNA2 homomeric channels) for comparison .

  • Verification of surface expression: Confirm trafficking to the plasma membrane using surface biotinylation or confocal microscopy with membrane markers.

  • Temperature controls: Conduct experiments at physiologically relevant temperatures, as channel kinetics can be highly temperature-dependent.

How should researchers approach the investigation of KCNS1 in epilepsy models?

Studies of KCNS1 in epilepsy models should consider:

  • Model selection: Choose appropriate models that recapitulate the temporal lobe epilepsy phenotype where KCNS1 dysregulation has been observed .

  • Temporal dynamics: Examine KCNS1 expression at multiple time points to distinguish between causative changes and compensatory responses.

  • Regional specificity: Analyze KCNS1 expression in different brain regions to identify region-specific changes.

  • Cellular resolution: Use single-cell approaches to determine whether KCNS1 dysregulation affects specific neuronal subtypes.

  • Functional correlates: Pair expression studies with electrophysiological recordings to connect molecular changes with functional outcomes.

  • Intervention studies: Use genetic or pharmacological approaches to modulate KCNS1 expression or function and assess effects on seizure susceptibility and severity.

What methodological approaches are recommended for studying KCNS1 channel regulation?

To investigate regulatory mechanisms controlling KCNS1 function:

  • Promoter analysis: Characterize the KCNS1 promoter region to identify transcription factor binding sites and regulatory elements.

  • Transcription factor studies: Investigate the role of specific transcription factors in regulating KCNS1 expression, possibly using the mRNA-TF network approach as described for other potassium channels .

  • miRNA regulation: Analyze potential miRNA binding sites in KCNS1 mRNA and validate functional interactions, similar to the ceRNA network approach used for other potassium channel genes .

  • Post-translational modifications: Investigate phosphorylation, ubiquitination, and other modifications that might regulate KCNS1 function.

  • Trafficking studies: Examine the mechanisms controlling KCNS1 transport to the plasma membrane, potentially by drawing parallels with trafficking mechanisms established for related channels like KCNA1 .

How can researchers effectively analyze KCNS1 expression data in disease states?

When analyzing KCNS1 expression data:

  • Statistical approaches: Use appropriate statistical tests based on data distribution. For comparing KCNS1 expression between normal and diseased tissues, t-tests are commonly employed for normally distributed data .

  • Multiple comparison corrections: When analyzing expression across multiple brain regions or time points, apply appropriate corrections for multiple comparisons.

  • Correlation analyses: Examine correlations between KCNS1 expression and disease parameters (e.g., seizure frequency, severity).

  • Network analysis: Consider using weighted gene co-expression network analysis (WGCNA) to identify modules of co-regulated genes that include KCNS1, as demonstrated in TLE research .

  • Pathway analysis: Conduct Gene Set Enrichment Analysis (GSEA) to identify biological pathways associated with KCNS1 dysregulation. Previous studies have linked potassium channel genes to cation channel function, respiratory chain, and oxidative phosphorylation pathways .

How should contradictory findings about KCNS1 function be reconciled?

When facing contradictory results:

  • Model system differences: Consider whether discrepancies arise from different experimental models (in vitro vs. in vivo, different cell types, acute vs. chronic manipulations).

  • Regional variations: Evaluate whether contradictory findings might reflect regional differences in KCNS1 function within the brain.

  • Developmental factors: Consider developmental stage as a potential source of variation in KCNS1 function.

  • Compensatory mechanisms: Assess whether acute vs. chronic manipulations of KCNS1 might trigger different compensatory responses.

  • Technical considerations: Evaluate differences in experimental techniques, including antibody specificity, RNA quality, and quantification methods.

  • Heteromeric composition: Investigate whether varying expression levels of partner subunits might explain functional differences, as KCNS1 properties likely depend on the composition of the channel complex, similar to KCNA1 .

What bioinformatic approaches are most useful for analyzing KCNS1 in large-scale genomic data?

For bioinformatic analyses of KCNS1:

  • Variant analysis: When examining KCNS1 variants, consider the potential functional impact using prediction tools that assess conservation, structural context, and biochemical properties.

  • Expression QTL analysis: Identify genetic variants that influence KCNS1 expression levels in different tissues and disease states.

  • Co-expression networks: Construct networks of genes co-expressed with KCNS1 to identify functional relationships and regulatory patterns, similar to the protein-protein interaction networks used for other potassium channel genes .

  • Comparative genomics: Analyze KCNS1 conservation across species to identify functionally important domains.

  • Regulatory element prediction: Use computational approaches to predict transcription factor binding sites, miRNA target sequences, and other regulatory elements affecting KCNS1 expression.

  • Drug-target prediction: Apply computational methods to identify potential small-molecule modulators of KCNS1, building upon identified compounds like enflurane, promethazine, and miconazole .

What are the most promising approaches for targeting KCNS1 therapeutically?

Based on current knowledge:

  • Small-molecule modulators: Enflurane, promethazine, and miconazole have been identified as potential KCNS1 modulators and could serve as starting points for drug development .

  • Gene therapy approaches: For conditions with reduced KCNS1 expression, viral vector-mediated delivery of KCNS1 might restore normal function.

  • RNA-based therapeutics: Antisense oligonucleotides or siRNAs could be developed to modulate KCNS1 expression in conditions where dysregulation occurs.

  • Transcriptional regulation: Targeting transcription factors that regulate KCNS1 expression could provide an indirect means of modulating KCNS1 levels.

  • Combinatorial approaches: Since multiple potassium channel genes often show coordinated dysregulation in epilepsy (including KCNA1, KCNA2, KCNJ11, and KCNS1), therapeutic strategies targeting multiple channels might be more effective than those focusing on KCNS1 alone .

What are the critical knowledge gaps in current KCNS1 research?

Despite recent advances, several important questions remain:

  • Precise stoichiometry: The exact composition of channel complexes containing KCNS1 in different neuronal populations remains unclear.

  • Subcellular localization: Detailed information about KCNS1 localization within neurons (soma, dendrites, axons, synapses) would provide insights into its functional roles.

  • Developmental regulation: The expression pattern of KCNS1 throughout development and its role in neural circuit formation requires further investigation.

  • Human data correlation: While animal studies have shown KCNS1 dysregulation in epilepsy, more data from human epilepsy patients would strengthen the clinical relevance of these findings.

  • Regulatory mechanisms: The transcriptional, post-transcriptional, and post-translational mechanisms controlling KCNS1 expression and function are not fully understood.

  • Interactions with non-channel proteins: Beyond interactions with other channel subunits, KCNS1 might interact with scaffolding proteins, trafficking molecules, or signaling complexes that influence its function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.