Recombinant Human Potassium voltage-gated channel subfamily S member 2 (KCNS2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant KCNS2 is synthesized using advanced biotechnological platforms:

  • Expression Systems:

    • E. coli: Yields full-length protein (1–477 aa) with >90% purity via affinity chromatography .

    • Tobacco (Nicotiana tabacum) cell-free systems: Produce tag-free or Strep-tagged variants for structural studies .

  • Purification:

    • His-tagged proteins use nickel affinity columns .

    • Strep-tagged versions employ Strep-Tactin® resin .

Functional and Mechanistic Roles

KCNS2 functions as an auxiliary subunit, modulating Kv2.x channels (e.g., KCNB1/KCNB2) to fine-tune electrical signaling:

  • Channel Modulation:

    • Alters activation kinetics and voltage dependence of Kv2.1/Kv2.2 channels .

    • Enhances delayed rectifier currents in neuronal and smooth muscle cells .

  • Pathophysiological Relevance:

    • Linked to neurological disorders due to impaired repolarization .

    • Indirectly implicated in hormone secretion via Kv channel regulation .

Research Applications

Recombinant KCNS2 is utilized in:

ApplicationProtocolRelevance
ELISAQuantification using anti-KCNS2 antibodies (e.g., ABIN7361235) Biomarker studies for neurological diseases
ElectrophysiologyCo-expressed with Kv2.x in HEK-293 cells to record potassium currents Channel kinetics analysis
Protein Interaction StudiesPull-down assays with KCNB1/KCNB2 subunits Subunit assembly mechanisms
Structural BiologyCrystallography of Strep-tagged KCNS2 Drug binding site mapping

Key Research Findings

  • Incretin Secretion: KCNS2’s paralog KCNH2 regulates GLP-1/GIP release in enteroendocrine cells, suggesting potential cross-talk with Kv9.2 .

  • Neurological Impact: KCNS2 knockdown prolongs action potential duration in neurons, implicating it in epilepsy and arrhythmias .

  • Structural Insights: The S4 voltage sensor domain (aa 200–250) is critical for channel gating .

Challenges and Future Directions

  • Heterogeneity: Functional studies require co-expression with primary α-subunits (e.g., KCNB1), complicating isolation of KCNS2-specific effects .

  • Therapeutic Potential: Targeting KCNS2-Kv2.x complexes may offer novel treatments for hyperexcitability disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCNS2; KIAA1144; Potassium voltage-gated channel subfamily S member 2; Delayed-rectifier K(+ channel alpha subunit 2; Voltage-gated potassium channel subunit Kv9.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-477
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNS2
Target Protein Sequence
MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCD DYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCS YSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNP GYSVLSRVFSILSILVVMGSIITMCLNSLPDFQIPDSQGNPGEDPRFEIVEHFGIAWFTF ELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESTPTLANLGRVAQVLRLM RIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTIEKEENEGLAT IPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQ KQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSLR
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It can form functional heterotetrameric channels with KCNB1 and KCNB2, modulating the activation and deactivation rates of KCNB1 and KCNB2 delayed rectifier voltage-gated potassium channels.
Database Links

HGNC: 6301

OMIM: 602906

KEGG: hsa:3788

STRING: 9606.ENSP00000287042

UniGene: Hs.388045

Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.2/KCNS2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is KCNS2 and what are its primary functional characteristics?

KCNS2 (potassium voltage-gated channel modifier subfamily S member 2, also known as KV9.2) is a protein-coding gene that functions as a regulatory subunit in voltage-gated potassium channel complexes. Unlike pore-forming alpha subunits, KCNS2 belongs to the "silent" KvS subfamily that cannot form functional homomeric channels but instead co-assembles with Kv2 subunits to form heterotetrameric Kv2/KvS channels with distinct biophysical properties .

KCNS2 is predicted to enable potassium channel regulator activity and is involved in action potential generation, potassium ion transmembrane transport, and regulation of potassium ion transmembrane transport. It is predicted to be located in the perinuclear region of the cytoplasm and plasma membrane as part of voltage-gated potassium channel complexes .

How does KCNS2 interact with other potassium channel subunits?

KCNS2, like other KvS subunits, does not form functional homomeric channels. Instead, it co-assembles with Kv2 subunits (primarily Kv2.1 or Kv2.2) to form heteromeric channels with distinct biophysical properties compared to homomeric Kv2 channels . This co-assembly creates channels with altered voltage dependence, activation/inactivation kinetics, and pharmacological sensitivities.

The expression patterns of KvS mRNAs, including KCNS2, are tissue and cell-specific, overlapping with Kv2.1 or Kv2.2 expression patterns. This suggests that in many cell types, the Kv2 conductances might actually be Kv2/KvS heteromeric conductances rather than homomeric Kv2 channels . These heteromeric associations allow for fine-tuning of neuronal excitability in distinct cell populations.

What is the genomic context and structure of the KCNS2 gene?

The KCNS2 gene is located on chromosome 8 at position 8q22.2. The specific genomic sequence is found on chromosome 8 at coordinates NC_000008.11 (98426958..98432853) according to the most recent genomic data. The gene contains only 2 exons, making it relatively compact compared to many other channel-encoding genes .

This genomic information is crucial for designing primers for genotyping, constructing expression vectors, and performing gene-editing experiments. Researchers should refer to the most recent genomic databases as coordinates may be updated with new genome assemblies.

What is the physiological significance of voltage-gated potassium channels like those containing KCNS2?

Voltage-gated potassium channels play diverse and critical roles in cellular physiology. These include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume . As a regulatory subunit, KCNS2 contributes to the modulation of these functions in specific cell types where it is expressed.

The cell-specific expression patterns of KCNS2 suggest specialized roles in particular neuronal populations. Understanding these specialized functions requires careful examination of KCNS2 expression patterns and the consequences of KCNS2 loss or gain of function in specific cell types.

How can researchers distinguish between homomeric Kv2 channels and heteromeric Kv2/KCNS2 channels in experimental settings?

This inhibitor combination can effectively distinguish conductances of Kv2-only channels from channels that contain KvS subunits (including KCNS2). Specifically, Kv2.1/Kv8.1 heteromers (and likely other Kv2/KvS heteromers) are resistant to RY785 but sensitive to GxTX, whereas homomeric Kv2 channels are sensitive to both inhibitors. This pharmacological approach allows researchers to identify native neuronal conductances consistent with Kv2/KvS heteromers in both mouse and human dorsal root ganglion neurons .

What expression systems are most effective for studying recombinant KCNS2?

For functional studies of heteromeric Kv2/KCNS2 channels, the most effective approach involves co-expression in a heterologous system. Based on the research methodologies described in the literature, a recommended approach is to use stable cell lines expressing Kv2.1 (such as Kv2.1-CHO cells) and transiently transfect them with KCNS2 cDNA. This approach allows for controlled expression and functional characterization of the heteromeric channels .

When designing expression constructs, researchers should consider including epitope tags that don't interfere with channel function to facilitate detection of protein expression and localization. Inducible expression systems may provide additional experimental control over the ratio of Kv2 to KCNS2 subunits.

What electrophysiological parameters should be analyzed when characterizing KCNS2-containing channels?

When characterizing KCNS2-containing channels electrophysiologically, researchers should examine multiple parameters that might be altered by the presence of KCNS2 subunits compared to homomeric Kv2 channels. Based on correlations observed between potassium channel expression and electrophysiological properties, key parameters to analyze include:

  • Voltage dependence of activation and inactivation

  • Activation and deactivation kinetics

  • Inactivation kinetics and recovery from inactivation

  • Single-channel conductance and open probability

  • Response to pharmacological agents (particularly GxTX and RY785)

  • Current density and surface expression

Research has shown that expression of specific potassium channel genes correlates with electrophysiological properties such as action potential firing rate, threshold, symmetry, and afterhyperpolarization. These correlations can provide insights into the functional consequences of KCNS2 expression in neurons .

What are the methodological challenges in studying native KCNS2-containing channels in neurons?

Studying native KCNS2-containing channels in neurons presents several methodological challenges:

  • Heterogeneity of channel composition: Neurons may express multiple KvS subunits alongside Kv2 subunits, creating heterogeneous channel populations.

  • Low expression levels: KCNS2 may be expressed at relatively low levels compared to pore-forming alpha subunits, making detection challenging.

  • Lack of specific antibodies: There may be limited availability of highly specific antibodies for KCNS2, complicating immunodetection studies.

  • Pharmacological complexity: Until recently, there were limited pharmacological tools to distinguish KCNS2-containing channels from other potassium channels.

  • Functional redundancy: Other KvS subunits may compensate for KCNS2 loss in knockout models, complicating phenotypic analysis.

To address these challenges, researchers are now employing advanced approaches including single-cell RNAseq combined with electrophysiological recording to correlate channel expression with functional properties at the single-cell level . Additionally, the development of specific pharmacological tools like the GxTX/RY785 combination provides new opportunities to isolate and characterize KCNS2-containing conductances .

What disease associations have been linked to KCNS2 and related KvS subunits?

Research on KvS subfamily members has linked disruptions in their function to various disorders. While specific information about KCNS2 is limited in the provided search results, other KvS subunits have been associated with:

  • Retinal cone dystrophy

  • Male infertility

  • Seizure disorders

  • Changes in pain sensitivity

Given the role of KCNS2 in regulating neuronal excitability, researchers investigating its potential involvement in neurological and psychiatric disorders should consider its possible contributions to conditions characterized by altered neuronal excitability, such as epilepsy or neuropathic pain.

Interestingly, a population-based study mentioned in the search results identified a variant in KCNH7 (another potassium channel gene) associated with bipolar spectrum disorder in Amish families . This suggests that variants in potassium channel genes, potentially including KCNS2, may contribute to psychiatric disorders in specific populations.

What expression vector systems are optimal for recombinant KCNS2 production?

For optimal recombinant KCNS2 production, researchers should consider the following expression vector characteristics:

  • Strong, controllable promoter: A CMV or similar strong promoter for mammalian expression, or an inducible promoter system for controlled expression levels.

  • Appropriate tags: N- or C-terminal tags that don't interfere with channel assembly or trafficking. For KCNS2, C-terminal tags are generally preferred as the N-terminus may contain important trafficking signals.

  • Codon optimization: Codon-optimized sequence for the expression system being used, particularly important for high-level expression.

  • Selection marker: Appropriate selection marker for generating stable cell lines.

  • Secretion signal: If secreted protein is desired, addition of an appropriate secretion signal sequence.

When co-expressing with Kv2 subunits, consider using a bicistronic vector or dual promoter system to ensure consistent co-expression ratios. Alternatively, establishing a stable Kv2-expressing cell line and then transiently transfecting with KCNS2 provides greater experimental flexibility .

What purification strategies are most effective for recombinant KCNS2?

Purification of membrane proteins like KCNS2 presents significant challenges. Based on general approaches for potassium channel purification:

  • Detergent solubilization: Careful selection of detergents is critical. Mild detergents like DDM (n-dodecyl-β-D-maltopyranoside) or LMNG (lauryl maltose neopentyl glycol) often preserve membrane protein structure.

  • Affinity purification: Utilizing affinity tags (His, FLAG, etc.) for initial capture, followed by size exclusion chromatography for further purification.

  • Native conditions: Maintaining physiological pH and including appropriate stabilizers (cholesterol, specific lipids) in buffers.

  • Co-purification: For functional studies, co-purification with Kv2 subunits may be necessary, as KCNS2 forms functional channels only as heteromers.

  • Quality control: Using multiple analytical methods to assess purity, homogeneity, and functional integrity, including SDS-PAGE, Western blotting, and potentially cryo-EM for structural studies.

It's important to note that the functional assessment of purified KCNS2 would require reconstitution with Kv2 subunits in a suitable membrane environment, such as proteoliposomes or nanodiscs, for electrophysiological or flux-based functional assays.

How can researchers validate the functional integrity of recombinant KCNS2?

Validating the functional integrity of recombinant KCNS2 requires demonstrating its ability to properly assemble with Kv2 subunits and modulate channel properties. Key validation approaches include:

  • Co-immunoprecipitation: Confirming physical association with Kv2 subunits.

  • Trafficking assays: Verifying correct cellular localization through immunofluorescence or surface biotinylation.

  • Electrophysiological characterization: Comparing the biophysical properties of Kv2 channels expressed alone versus co-expressed with KCNS2. Key parameters include:

    • Voltage-dependence of activation and inactivation

    • Activation and inactivation kinetics

    • Sensitivity to specific channel modulators

  • Pharmacological profiling: Testing sensitivity to the GxTX/RY785 inhibitor combination, which can distinguish Kv2 homomers from Kv2/KvS heteromers .

  • Mutational analysis: Introducing known functional mutations in KCNS2 and confirming their predicted effects on channel function.

A comprehensive validation approach would combine multiple methods to ensure that the recombinant KCNS2 protein exhibits the expected molecular interactions and functional effects.

How can single-cell transcriptomics advance our understanding of KCNS2 function?

Single-cell RNA sequencing (scRNAseq) represents a powerful approach for understanding KCNS2 function in complex tissues like the nervous system. Recent advances in this methodology allow researchers to correlate gene expression with electrophysiological properties at the single-cell level.

Research has demonstrated that expression of specific potassium channel genes correlates with electrophysiological properties such as action potential firing rate, threshold, and afterhyperpolarization . By applying scRNAseq to neurons with defined electrophysiological properties, researchers can:

  • Identify specific cell types expressing KCNS2

  • Determine co-expression patterns with Kv2 and other channel subunits

  • Correlate KCNS2 expression levels with specific physiological properties

  • Identify transcriptional networks regulating KCNS2 expression

This approach enables the development of a mechanistic understanding of how KCNS2 contributes to the diversity of neuronal excitability patterns in different cell types and brain regions.

What are promising research directions for understanding KCNS2's role in neurological disorders?

Based on the involvement of other KvS subunits in neurological conditions like seizures and pain sensitivity , several promising research directions for KCNS2 include:

  • Genetic association studies: Examining KCNS2 variants in patients with epilepsy, neuropathic pain, or other excitability disorders.

  • Conditional knockout models: Developing cell type-specific or inducible KCNS2 knockout models to assess function in specific neural circuits.

  • Electrophysiological profiling: Characterizing the effects of KCNS2 loss or dysfunction on neuronal excitability in relevant cell types.

  • Pharmacological modulation: Developing compounds that selectively modulate Kv2/KCNS2 heteromeric channels as potential therapeutic tools.

  • Disease model validation: Testing whether restoring or modulating KCNS2 function can ameliorate symptoms in relevant disease models.

The discovery that mutations in potassium channel genes can contribute to psychiatric disorders, as demonstrated for KCNH7 in bipolar spectrum disorder , suggests that KCNS2 variants might also contribute to psychiatric conditions characterized by altered neural excitability.

What methodological advances would significantly enhance KCNS2 research?

Several methodological advances would substantially enhance KCNS2 research:

  • Specific antibodies: Development of highly specific antibodies for immunodetection of KCNS2 in native tissues.

  • Selective modulators: Discovery of pharmacological agents that selectively target Kv2/KCNS2 heteromeric channels.

  • Cryo-EM structures: Determination of high-resolution structures of Kv2/KCNS2 heteromeric channels to guide structure-based drug design.

  • Improved expression systems: Development of expression systems that allow controlled, stoichiometric assembly of Kv2/KCNS2 heteromers.

  • In vivo imaging tools: Genetically encoded sensors to visualize KCNS2 trafficking and assembly in live neurons.

  • Computational models: Advanced computational models that accurately predict the functional consequences of KCNS2 variants.

These methodological advances would enable more precise investigation of KCNS2's physiological roles and potential contributions to disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.