Recombinant Human Potassium voltage-gated channel subfamily S member 3 (KCNS3)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

KCNS3 encodes the Kv9.3 α-subunit, an electrically silent voltage-gated potassium channel modulator that forms heterotetrameric complexes with functional Kv2.1 (KCNB1) or Kv2.2 (KCNB2) subunits . These heteromers exhibit distinct biophysical properties, including faster activation kinetics and altered voltage sensitivity compared to homomeric Kv2.1 channels . The recombinant human KCNS3 protein enables researchers to investigate these interactions and their implications in neuronal signaling, cancer, and neuropsychiatric disorders.

Recombinant Production and Variants

Recombinant KCNS3 is produced in multiple expression systems, with variations tailored for specific experimental needs:

Host SystemPurityApplicationsSource
E. coli≥85%Structural studies, antibody production
Mammalian (HEK293)≥85%Functional channel assays
Wheat germ≥85%ELISA, Western blot
Baculovirus≥85%High-yield protein production

Key epitopes include residues 671–757, which are critical for subunit assembly and channel modulation .

Biochemical Roles

  • Delayed rectifier activity: Modulates action potential repolarization in neurons .

  • Potassium channel regulation: Alters Kv2.1/Kv2.2 kinetics, shifting activation thresholds by ~20 mV .

Protein Interactions

Interacting PartnerFunctional ImpactDetection Method
Kv2.1 (KCNB1)Forms heteromers with 3:1 stoichiometryCo-IP, electrophysiology
HSP90AB1Facilitates protein folding/stabilityYeast two-hybrid

Neurological Disorders

  • Schizophrenia: KCNS3 mRNA is reduced by 23% in prefrontal cortical parvalbumin neurons, correlating with impaired GABAergic signaling .

  • Bipolar disorder: Altered KCNS3 expression interacts with ANK3 and KCNQ2/3 genes, suggesting ion channelopathy mechanisms .

Cancer Biology

  • Proliferation: Silencing KCNS3 in HCT15 colon carcinoma and A549 lung adenocarcinoma cells reduces tumor growth in xenograft models by arresting the cell cycle at G0/G1 phase .

  • Therapeutic target: KV9.3 expression is regulated by Sp1 transcription factors, making it sensitive to inhibitors like mithramycin A .

Neuronal Specificity

  • KCNS3 is a selective marker for parvalbumin-containing GABAergic neurons in the human prefrontal cortex, with 90% co-localization .

Applications in Research

  • Channel modulation studies: Recombinant KCNS3 enables precise analysis of Kv2.1/Kv9.3 heteromer kinetics .

  • Drug discovery: Used to screen compounds targeting Kv9.3-associated pathologies (e.g., schizophrenia, cancer) .

  • Antibody development: Epitope-specific antibodies generated against recombinant KCNS3 aid in immunohistochemistry and Western blotting .

Challenges and Future Directions

  • Structural resolution: Full-length KCNS3 structure remains undetermined due to technical hurdles in membrane protein crystallization.

  • Therapeutic validation: In vivo efficacy of KCNS3-targeted therapies requires further preclinical testing .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
KCNS3; Potassium voltage-gated channel subfamily S member 3; Delayed-rectifier K(+ channel alpha subunit 3; Voltage-gated potassium channel subunit Kv9.3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-491
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNS3
Target Protein Sequence
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY SVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNR YQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAY CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAVR LAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDHTSSLTSIPIC WWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID VDQCSEDAPEKCHELPYFNIRDIYAQRMHTFITSLSSVGIVVSDPDSTDASSIEDNEDIC NTTSLENCTAK
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It can form functional heterotetrameric channels with KCNB1, modulating the activation and deactivation rates of the KCNB1 delayed rectifier voltage-gated potassium channel. Heterotetrameric channels formed with KCNB1 exhibit increased current amplitude, with the threshold for action potential activation shifted towards more negative values in hypoxic-treated pulmonary artery smooth muscle cells.
Gene References Into Functions
  1. In situ hybridization revealed 23% lower KCNS3 mRNA levels in schizophrenia subjects compared to controls. At the cellular level, both KCNS3 mRNA-expressing neuron density and KCNS3 mRNA level per neuron were significantly lower. PMID: 24170294
  2. The study concluded that potassium voltage-gated channel K(V)9.3 is localized to human placental vascular tissues and syncytiotrophoblast. PMID: 22943705
  3. Stromatoxin-1-sensitive KV2-containing channels are expressed in detrusor smooth muscle (DSM); they regulate DSM excitability, intracellular Ca2+ levels, and myogenic and nerve-evoked contractions. PMID: 22422395
  4. Evidence supports the expression of heteromultimeric Kv2.1/Kv9.3 channels in the control of middle cerebral arterial diameter. PMID: 20876197
  5. Our findings suggest that SNPs located in the 3' downstream region of KCNS3 play a significant role in the etiology of AHR. PMID: 15714333

Show More

Hide All

Database Links

HGNC: 6302

OMIM: 603888

KEGG: hsa:3790

STRING: 9606.ENSP00000305824

UniGene: Hs.414489

Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.3/KCNS3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in whole normal term placental and placental chorionic plate arteries and veins. Detected in syncytiotrophoblast and in blood vessel endothelium within intermediate villi and chorionic plate (at protein level). Detected in most tissues, but not i

Q&A

What is the cellular expression pattern of KCNS3 in the human brain?

KCNS3, encoding the Kv9.3 voltage-gated potassium channel modulatory α-subunit, is selectively expressed in parvalbumin-positive (PV) neurons in the human prefrontal cortex . Expression studies using in situ hybridization have demonstrated that KCNS3 mRNA signals are predominantly high in cortical layers 2 to 5, with the highest signal density observed in layer 4 . Layer 6 exhibits the lowest signal density, while layer 1 shows no specific hybridization signal . This distinct laminar distribution pattern suggests that KCNS3 plays a specialized role in cortical circuitry, particularly in regions containing high densities of PV neurons.

To accurately characterize KCNS3 expression, researchers should employ multiple complementary techniques:

  • In situ hybridization with 35S-labeled riboprobes for mRNA detection

  • Immunohistochemistry with parvalbumin co-labeling

  • Single-cell RNA sequencing for cell-type specific expression profiling

  • Quantitative PCR for relative expression level assessment

How does KCNS3/Kv9.3 function in relation to other potassium channels?

Kv9.3 subunits, encoded by KCNS3, do not assemble into homomeric channels but instead form functional heteromeric channels with delayed rectifier Kv2.1 α-subunits, which are expressed by the majority of cortical neurons including parvalbumin neurons . These heteromeric Kv2.1/Kv9.3 channels display distinctive biophysical properties compared to homomeric Kv2.1 channels:

  • Faster activation kinetics

  • Slower deactivation and inactivation

  • Steady-state activation and inactivation curves shifted toward more negative values by approximately 20 mV

These modified properties result in channels that are more effectively activated by subthreshold membrane depolarizations, such as those generated by excitatory synaptic inputs . This suggests that Kv9.3 subunits serve as modulators that fine-tune the electrophysiological properties of Kv2.1-containing channels to support the unique fast-spiking phenotype of PV neurons.

What experimental methods are most effective for studying KCNS3 function?

To effectively study KCNS3 function, researchers should implement a multi-modal approach:

  • Genetic Models: Using Kcns3-deficient mice as demonstrated in recent studies, where Kcns3 mRNA levels were ~50% lower in cortical PV neurons compared to wildtype controls .

  • Electrophysiology: Whole-cell patch-clamp recordings in acute brain slices to assess:

    • Action potential waveforms

    • Firing patterns (particularly the fast-spiking phenotype)

    • Stuttering patterns that may emerge with KCNS3 deficiency

  • Computational Modeling: Simulating the effects of altering Kv2.1-mediated currents to predict physiological consequences of KCNS3 modulation .

  • Molecular Biology:

    • In situ hybridization for cellular localization

    • qPCR for quantitative expression analysis

    • Co-immunoprecipitation to confirm heteromeric assembly with Kv2.1

  • Heterologous Expression Systems: Recombinant expression in cell lines (such as HEK293) to characterize channel biophysics through voltage-clamp recordings.

How does KCNS3 deficiency specifically affect the electrophysiological properties of parvalbumin-positive neurons?

KCNS3 deficiency substantially alters the characteristic fast-spiking (FS) phenotype of parvalbumin-positive neurons. Studies using Kcns3-deficient mice have revealed specific electrophysiological consequences:

To effectively study these effects, researchers should employ simultaneous patch-clamp recordings and calcium imaging in brain slices, combined with optogenetic manipulation of specific neuronal populations to analyze circuit-level consequences.

What are the methodological challenges in studying KCNS3 given that Kv9.3 subunits do not form homomeric channels?

The inability of Kv9.3 subunits to form functional homomeric channels presents several methodological challenges that require specialized approaches:

  • Heteromeric Channel Analysis: Researchers must design experiments that can distinguish the properties of Kv2.1/Kv9.3 heteromers from homomeric Kv2.1 channels. This requires:

    • Co-expression systems with controlled ratios of both subunits

    • Biophysical characterization through detailed voltage protocols

    • Pharmacological tools that can differentiate channel configurations

  • Native Channel Isolation: Isolating the specific contribution of Kv9.3-containing channels in native neurons is challenging due to the presence of multiple potassium channel types. Approaches include:

    • Selective genetic knockdown/knockout of KCNS3

    • Mathematical decomposition of recorded currents

    • Single-channel recordings to identify distinct conductance states

  • Protein Interaction Studies: Special techniques are required to confirm Kv2.1-Kv9.3 interactions:

    • FRET/BRET to assess proximity in live cells

    • Co-immunoprecipitation with sensitive detection methods

    • Mass spectrometry of purified channel complexes

  • Recombinant Protein Production: For biochemical studies, researchers must optimize heterologous expression systems that maintain proper subunit assembly, similar to approaches used for other potassium channel proteins .

What is the significance of altered KCNS3 expression in schizophrenia and how should researchers investigate this relationship?

Accumulating evidence indicates that KCNS3 expression is altered in schizophrenia, suggesting a potential pathophysiological role. Research has demonstrated:

  • Expression Deficits: KCNS3 mRNA levels are approximately 23% lower in the prefrontal cortex of schizophrenia subjects as measured by in situ hybridization .

  • Cellular Specificity: Both the density of KCNS3 mRNA-expressing neurons and the KCNS3 mRNA level per neuron are significantly reduced in schizophrenia .

  • Cell Type-Specific Reduction: Microarray analyses of neurons labeled with Vicia villosa agglutinin (VVA), a parvalbumin neuron-selective marker, revealed a 40% reduction in KCNS3 mRNA levels in schizophrenia subjects .

To effectively investigate this relationship, researchers should implement a comprehensive strategy:

  • Causality Assessment: Determine whether KCNS3 downregulation is a primary pathogenic mechanism or a compensatory response by studying temporal dynamics in animal models.

  • Functional Consequences: Evaluate how reduced KCNS3 expression affects PV neuron excitability and network function using electrophysiology and computational modeling.

  • Therapeutic Potential: Explore whether normalizing KCNS3 function can ameliorate schizophrenia-related neural circuit abnormalities.

  • Statistical Considerations: Employ robust statistical methods that account for covariates such as age, RIN (RNA Integrity Number), and storage time, which have been shown to influence KCNS3 expression measurements .

How can researchers distinguish the effects of KCNS3 (Kv9.3) from those of other potassium channel modulatory subunits?

Distinguishing the specific contributions of KCNS3/Kv9.3 from other potassium channel modulatory subunits requires systematic experimental designs:

  • Selective Genetic Manipulation: Generate conditional knockout models with cell-type and temporal specificity to isolate KCNS3 effects.

  • Comparative Electrophysiology: Perform detailed biophysical characterization of channels containing different modulatory subunits, focusing on:

    • Activation/inactivation kinetics

    • Voltage dependence of gating

    • Response to frequency-dependent stimulation

    • Sensitivity to various pharmacological agents

  • Subunit-Specific Antibodies: Develop highly specific antibodies that can distinguish between closely related channel subunits for immunohistochemistry and biochemical assays.

  • Expression Correlation Analysis: Analyze co-expression patterns of KCNS3 with other channel subunits across different cell types and brain regions to identify unique expression signatures.

  • Functional Redundancy Assessment: Systematically investigate whether other modulatory subunits can compensate for KCNS3 deficiency by performing rescue experiments in KCNS3-deficient models.

What are optimal experimental designs for assessing the impact of KCNS3 dysfunction on neural circuit activity?

To effectively assess how KCNS3 dysfunction affects neural circuits, researchers should implement multi-level experimental designs:

  • In Vitro Circuit Analysis:

    • Dual/multiple patch-clamp recordings in brain slices to assess synaptic connectivity

    • Voltage-sensitive dye imaging to visualize circuit-wide activity patterns

    • Local field potential recordings to measure network oscillations, particularly in gamma frequency ranges that depend on PV neuron function

  • In Vivo Approaches:

    • Multi-electrode array recordings in awake, behaving animals with KCNS3 manipulation

    • Two-photon calcium imaging of identified neuronal populations

    • Optogenetic stimulation/inhibition combined with electrophysiology

  • Behavioral Correlates:

    • Cognitive testing paradigms focusing on functions known to involve PV neurons

    • Sensory processing tasks that depend on precise timing of inhibitory control

    • Working memory assessments to correlate with PV neuron activity patterns

  • Translational Approaches:

    • EEG/MEG studies in humans carrying KCNS3 variants

    • Computational modeling that bridges cellular KCNS3 effects to circuit-level predictions

    • iPSC-derived neuronal cultures from patients with altered KCNS3 expression

What are the best methodological approaches for producing functional recombinant KCNS3 for in vitro studies?

Producing functional recombinant KCNS3 for in vitro studies presents unique challenges due to its modulatory nature. Based on approaches used for similar channel proteins, researchers should consider:

  • Expression Systems:

    • HEK293 cells for electrophysiological studies requiring co-expression with Kv2.1

    • Cell-free protein synthesis (CFPS) systems for biochemical and structural studies

    • Baculovirus-infected insect cells for higher protein yields

  • Purification Strategies:

    • Affinity tags (Strep-Tag, His-tag) for single-step purification

    • Size exclusion chromatography for isolation of intact channel complexes

    • Consider native purification conditions to maintain protein-protein interactions

  • Functional Verification:

    • Patch-clamp electrophysiology to confirm channel function

    • Binding assays to verify Kv2.1 interaction

    • Western blotting to assess protein integrity

    • Analytical size exclusion chromatography (SEC) to confirm proper assembly

  • Quality Control Metrics:

    • Purity assessment by SDS-PAGE and Western blot (aim for >70-80% purity)

    • Thermal stability assays to ensure proper folding

    • Mass spectrometry to confirm protein identity and post-translational modifications

How should researchers analyze and interpret contradictory findings regarding KCNS3 function?

When encountering contradictory findings regarding KCNS3 function, researchers should implement a systematic approach to data analysis and interpretation:

  • Methodological Reconciliation:

    • Compare experimental conditions, including recording solutions, temperature, and expression systems

    • Evaluate differences in animal models (species, age, sex, genetic background)

    • Assess cell type specificity, as effects may differ between neuronal populations

  • Statistical Considerations:

    • Conduct power analyses to ensure adequate sample sizes

    • Apply appropriate statistical tests considering data distribution and experimental design

    • Use ANCOVA models that account for relevant covariates such as age, RIN, and storage time

  • Integrative Analysis Framework:

    • Combine data from multiple approaches (electrophysiology, imaging, behavior)

    • Use computational modeling to test whether seemingly contradictory results can be explained by a unified mechanistic framework

    • Perform meta-analyses when sufficient literature exists

  • Contextual Interpretation:

    • Consider developmental stage, as KCNS3 function may change across development

    • Evaluate circuit context, as the same molecular alteration may have opposite effects in different circuits

    • Assess state-dependent effects related to neuronal activity levels

What specific statistical approaches are most appropriate for analyzing KCNS3 expression data in disease studies?

Based on published studies on KCNS3 in schizophrenia, the following statistical approaches are recommended for disease-related expression studies:

  • Matched Pair Designs:

    • Pair patients and controls based on key demographic variables (sex, age)

    • Use paired t-tests or Wilcoxon signed-rank tests for direct comparisons

    • Apply paired ANCOVA models with subject pair as a blocking factor

  • Covariate Analysis:

    • Perform preliminary ANCOVA to identify significant covariates

    • Include identified covariates in the final analysis models

    • For KCNS3, important covariates include age, RIN, and storage time

  • Multiple Testing Correction:

    • Apply appropriate corrections (Bonferroni, FDR) when analyzing multiple brain regions or cell types

    • Use q-values rather than p-values when conducting exploratory analyses

  • Data Transformation:

    • Apply log₂ transformation for microarray data as demonstrated in published studies

    • Calculate signal ratios between patient and control samples within matched pairs

  • Correlation Analyses:

    • Use Pearson's correlation to assess relationships between KCNS3 and other channel subunits (e.g., KCNB1)

    • Correlate expression levels with clinical measures to establish functional relevance

What are the most promising translational applications of KCNS3 research?

KCNS3 research holds significant translational potential across several domains:

  • Therapeutic Target Development:

    • Design compounds that modulate Kv2.1/Kv9.3 channel function to normalize PV neuron activity

    • Develop cell type-specific gene therapy approaches to restore KCNS3 expression in psychiatric disorders

    • Create screening platforms to identify molecules that can rescue KCNS3 deficiency-related phenotypes

  • Biomarker Identification:

    • Establish whether peripheral KCNS3 expression correlates with central nervous system alterations

    • Develop imaging ligands that can assess Kv channel function in vivo

    • Identify downstream molecular signatures of altered KCNS3 function

  • Precision Medicine Applications:

    • Stratify patients based on KCNS3 expression or function to predict treatment response

    • Design personalized interventions that target specific KCNS3-related circuit abnormalities

    • Use computational modeling to predict individual responses to channel-modulating therapies

  • Cognitive Enhancement Strategies:

    • Based on evidence from other potassium channels like KCNN3 that affect cognitive performance , explore whether modulating KCNS3 function could enhance cognitive abilities

    • Develop targeted interventions for cognitive domains specifically affected by PV neuron dysfunction

How might researchers integrate KCNS3 studies with broader investigations of neural circuit dysfunction in psychiatric disorders?

To maximize impact, KCNS3 research should be integrated with broader neural circuit investigations:

  • Multi-level Research Programs:

    • Connect molecular KCNS3 alterations to cellular, circuit, and behavioral phenotypes

    • Investigate interactions between KCNS3 dysfunction and other pathophysiological mechanisms

    • Develop computational models that can predict how KCNS3-related cellular changes affect network function

  • Cross-Disorder Comparisons:

    • Compare KCNS3 alterations across psychiatric conditions with PV neuron dysfunction

    • Identify common and distinct consequences of KCNS3 dysfunction in different disorders

    • Establish whether KCNS3 alterations represent a shared pathophysiological mechanism

  • Integrative "-omics" Approaches:

    • Combine transcriptomics, proteomics, and functional genomics to understand KCNS3 regulation

    • Use single-cell approaches to identify cell type-specific consequences of KCNS3 dysfunction

    • Apply systems biology methods to position KCNS3 within broader disease networks

  • Developmental Perspectives:

    • Investigate how KCNS3 dysfunction affects critical periods of cortical development

    • Explore potential preventive interventions targeting KCNS3 function during key developmental windows

    • Study interactions between KCNS3 and environmental factors across the lifespan

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.