Recombinant Human Potassium voltage-gated channel subfamily V member 1 (KCNV1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KCNV1; Potassium voltage-gated channel subfamily V member 1; Neuronal potassium channel alpha subunit HNKA; Voltage-gated potassium channel subunit Kv8.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-500
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KCNV1
Target Protein Sequence
MPSSGRALLDSPLDSGSLTSLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQALSCF PHTRLGKLAVVVASYRRPGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYRTG RLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQHES EQDFSQGPCPTVRQKLWNILEKPGSSTAARIFGVISIIFVVVSIINMALMSAELSWLDLQ LLEILEYVCISWFTGEFVLRFLCVRDRCRFLRKVPNIIDLLAILPFYITLLVESLSGSQT TQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGISIF STVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGILVL ALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIMEML RLKGRERASTRSSGGDDFWF
Uniprot No.

Target Background

Function

Potassium channel subunit incapable of forming functional channels independently. It modulates KCNB1 and KCNB2 channel activity by shifting the inactivation threshold to more negative potentials and slowing the inactivation rate. It may downregulate the channel activity of KCNB1, KCNB2, KCNC4, and KCND1, potentially by retaining them within intracellular membranes.

Database Links

HGNC: 18861

OMIM: 608164

KEGG: hsa:27012

STRING: 9606.ENSP00000297404

UniGene: Hs.13285

Protein Families
Potassium channel family, V (TC 1.A.1.2) subfamily, Kv8.1/KCNV1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Has to be associated with another potassium channel subunit to get inserted in the plasma membrane. Remains intracellular in the absence of KCNB2.
Tissue Specificity
Detected in brain.

Q&A

What is KCNV1 and what is its primary function?

KCNV1 (Potassium Voltage-Gated Channel Modifier Subfamily V Member 1) is a protein-coding gene that produces a potassium channel subunit. Unlike typical potassium channels, KCNV1 does not form functional channels by itself but instead acts as a modulator of other potassium channels. Its primary function is to regulate the activity of KCNB1, KCNB2, KCNC4, and KCND1 channels by shifting their inactivation threshold to more negative values and slowing their inactivation rate . This modulatory role is critical for fine-tuning neuronal excitability, particularly in the brain where KCNV1 is predominantly expressed .

What cellular components and biological processes involve KCNV1?

KCNV1 is an integral membrane protein that localizes to the plasma membrane and voltage-gated potassium channel complexes . At the molecular level, KCNV1 exhibits ion channel inhibitor activity and potassium channel regulator activity . The protein participates in several biological processes including:

  • Potassium ion transport

  • Protein homooligomerization

  • Regulation of molecular function

What are the key structural features of KCNV1?

KCNV1 belongs to the potassium channel family, specifically the V subfamily (TC 1.A.1.2) . As a multi-pass integral membrane protein, KCNV1 shares structural similarities with other voltage-gated potassium channels in the 6-TM (transmembrane) family . Key structural features include:

  • Multiple transmembrane domains that anchor the protein within the membrane

  • Regions that interact with other channel subunits (particularly KCNB1 and KCNB2)

  • Domains involved in voltage sensing

  • Portions that participate in protein-protein interactions that enable trapping of other channels in intracellular membranes

Understanding these structural elements is essential for investigating how KCNV1 exerts its modulatory effects on target channels.

How should researchers design electrophysiology experiments to study KCNV1's modulatory effects?

When designing electrophysiology experiments to study KCNV1's modulatory effects, researchers should:

  • Co-expression system: Since KCNV1 does not form functional channels alone, design experiments that co-express KCNV1 with its target channels (KCNB1, KCNB2, KCNC4, or KCND1) in appropriate expression systems .

  • Voltage protocols: Implement specific voltage-clamp protocols that can detect shifts in inactivation threshold and changes in inactivation kinetics, as these are the primary modulatory effects of KCNV1 .

  • Control conditions: Include control conditions with target channels expressed alone without KCNV1 to establish baseline electrophysiological properties.

  • Dose-dependent effects: Consider testing various ratios of KCNV1 to target channel expression to determine whether modulatory effects are concentration-dependent.

  • Automated platforms: For higher throughput analysis, automated electrophysiology platforms similar to those used for KCNQ1 variant studies can be repurposed for KCNV1 research .

This experimental design allows researchers to quantitatively assess how KCNV1 modifies the biophysical properties of its target channels.

What expression systems are most effective for recombinant KCNV1 production?

Based on common practices for potassium channel research and information from related channels, researchers have several options for recombinant KCNV1 production:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, challenges with membrane proteinsProtein fragments, soluble domains
YeastEukaryotic processing, moderate costMay differ from mammalian glycosylationFull-length protein when mammalian cells not required
Baculovirus/Insect cellsHigher-order folding, post-translational modificationsMore complex, higher cost than bacteria/yeastFull-length functional studies
Mammalian cellsNative-like processing and foldingHighest cost, lower yieldsFunctional studies, interaction studies

What tagging strategies are recommended for recombinant KCNV1 studies?

When designing recombinant KCNV1 constructs, researchers should consider the following tagging strategies:

  • Affinity tags: His-tags or FLAG-tags positioned at the N- or C-terminus facilitate purification while minimally affecting function.

  • Fluorescent protein fusions: GFP or similar fluorescent protein tags enable visualization of cellular localization and trafficking, though care must be taken to ensure the fusion doesn't disrupt function.

  • Biotinylation tags: Avi-tag biotinylation (as seen with related channels) allows for highly specific labeling and can be used for protein-protein interaction studies .

  • Tag positioning considerations:

    • N-terminal tags are generally preferable as the C-terminus may be involved in protein-protein interactions

    • Include linker sequences between the tag and KCNV1 to minimize functional interference

    • Validate that the tag doesn't alter the modulatory function of KCNV1 on target channels

Each tagging approach should be experimentally validated to ensure that KCNV1's modulatory functions remain intact.

How can researchers investigate the mechanism by which KCNV1 traps other channels in intracellular membranes?

The mechanism by which KCNV1 traps other potassium channels in intracellular membranes represents an intriguing regulatory phenomenon that requires sophisticated experimental approaches:

  • Subcellular fractionation: Isolate different membrane compartments (plasma membrane, ER, Golgi) and quantify the distribution of target channels with and without KCNV1 co-expression.

  • Live cell imaging: Employ fluorescently tagged channels and KCNV1 with time-lapse confocal microscopy to track trafficking dynamics in real-time.

  • Deletion and mutation analysis: Create a series of KCNV1 constructs with specific domains deleted or mutated to identify regions responsible for the trapping effect.

  • Protein-protein interaction mapping: Use techniques such as proximity labeling (BioID), co-immunoprecipitation, or FRET to identify the molecular interfaces between KCNV1 and its target channels.

  • High-resolution microscopy: Implement super-resolution techniques (STORM, PALM) to visualize the precise subcellular localization of channel complexes.

These approaches can provide complementary data to elucidate the molecular mechanism behind this important regulatory function of KCNV1 .

What computational approaches can predict the functional impact of KCNV1 variants?

While no KCNV1-specific computational prediction tools are currently available, researchers can adapt approaches used for related potassium channels like KCNQ1:

  • Conservation analysis: Analyze evolutionary conservation patterns across KCNV1 subdomains to identify critical functional regions, similar to the approach used for KCNQ1 .

  • Machine learning models: Train neural networks on functionally characterized variants, as demonstrated by Q1VarPred for KCNQ1 . This approach could be adapted for KCNV1 once sufficient functional data is available.

  • Structural modeling: Generate homology models of KCNV1 based on related potassium channels with resolved structures to predict how variants might affect protein conformation and interaction surfaces.

  • Metrics for evaluation: Use robust statistical measures such as Matthew's correlation coefficient (MCC) and area under the receiver operating characteristic curve (AUC) to evaluate prediction performance .

The development of KCNV1-specific variant prediction tools would significantly benefit from high-throughput functional characterization data, similar to the approach described for KCNQ1 variants .

How can high-throughput methods be adapted for functional characterization of KCNV1 variants?

Adapting high-throughput methods for KCNV1 variant characterization requires special consideration of its modulatory nature:

  • Automated electrophysiology platforms: Repurpose platforms used for ion channel drug discovery, similar to those used for KCNQ1 variant testing . For KCNV1, these would need to measure effects on co-expressed target channels rather than direct channel function.

  • Fluorescence-based assays: Develop membrane potential or ion flux assays that can indirectly measure KCNV1's modulatory effects in a plate-based format.

  • Co-expression systems: Create stable cell lines expressing target channels (KCNB1, KCNB2) that can be transiently transfected with KCNV1 variant constructs.

  • Quantitative parameters: Establish clear metrics that define normal versus abnormal modulatory function:

    • Shift in voltage-dependent inactivation

    • Change in inactivation kinetics

    • Alteration in channel surface expression

  • Data analysis pipeline: Implement automated analysis algorithms that can process large datasets and classify variants based on predetermined functional thresholds.

This approach would enable researchers to classify KCNV1 variants as having normal, partial, or complete loss of modulatory function .

What is the evidence linking KCNV1 to human diseases?

Current evidence suggests associations between KCNV1 and specific conditions, though the mechanistic understanding remains incomplete:

  • Capillary Malformations, Congenital: KCNV1 has been associated with this vascular development disorder, potentially through effects on cellular excitability or signaling in vascular tissues .

  • Appendix Carcinoid Tumor: There is an association between KCNV1 and this rare type of neuroendocrine tumor, though the mechanistic basis requires further investigation .

  • Neurological implications: Given KCNV1's predominant expression in the brain and its role in modulating neuronal excitability, research is ongoing to explore potential links to neurological conditions, particularly those involving altered excitability.

Future research using genome-wide association studies, targeted sequencing in patient populations, and functional characterization of patient-derived variants will help clarify KCNV1's role in disease pathophysiology.

What experimental models are appropriate for studying KCNV1-related pathophysiology?

Researchers investigating KCNV1's role in disease can consider several experimental models:

  • Heterologous expression systems: HEK293 or CHO cells co-expressing KCNV1 with its target channels provide controlled environments for basic mechanistic studies.

  • Primary neuronal cultures: Since KCNV1 is predominantly expressed in the brain, primary neurons offer a more physiologically relevant context for studying its function.

  • Brain slice preparations: For examining KCNV1's effect on circuit-level neurophysiology, acute or organotypic brain slices maintain much of the native neural architecture.

  • Animal models:

    • Knockout mice lacking KCNV1 expression

    • Knockin mice expressing disease-associated KCNV1 variants

    • Conditional expression systems for tissue-specific and temporal control

  • iPSC-derived models: Patient-derived induced pluripotent stem cells differentiated into relevant cell types (neurons, vascular cells) offer a human-specific platform for disease modeling.

When designing these models, researchers should consider the co-expression of KCNV1's target channels, as its modulatory function depends on their presence .

What quality control measures are essential when working with recombinant KCNV1?

To ensure reliable results when working with recombinant KCNV1, researchers should implement the following quality control measures:

  • Expression verification: Confirm protein expression using Western blotting, with attention to both total protein levels and subcellular localization.

  • Functional validation: Verify KCNV1's modulatory activity on target channels using electrophysiological approaches before proceeding with experimental investigations.

  • Batch consistency: When producing multiple batches of recombinant KCNV1, implement standardized quality checks to ensure consistent protein characteristics across experiments.

  • Stability assessment: Determine the stability of recombinant KCNV1 under various storage conditions and establish appropriate protocols to maintain functional integrity.

  • Purity verification: For biochemical and structural studies, confirm protein purity using methods such as SDS-PAGE or mass spectrometry.

  • Tag influence testing: Validate that any tags or fusion partners don't significantly alter KCNV1's functional properties or interactions with target channels.

These quality control measures are crucial for generating reproducible and reliable data in KCNV1 research .

How can researchers differentiate between direct and indirect effects of KCNV1 in experimental settings?

Distinguishing direct modulatory effects of KCNV1 from indirect consequences presents a significant challenge. Researchers can implement these methodological approaches:

  • Mutation-based approaches:

    • Create functionally inactive KCNV1 mutants that maintain protein-protein interactions

    • Compare effects of wild-type versus mutant KCNV1 on target channels

    • Use these controls to distinguish between physical interaction effects and functional modulation

  • Temporal manipulation:

    • Employ inducible expression systems to control the timing of KCNV1 expression

    • Monitor acute versus chronic effects of KCNV1 on target channel properties and trafficking

  • Domain-specific interventions:

    • Generate chimeric constructs swapping domains between KCNV1 and related subunits

    • Identify specific domains responsible for different aspects of channel modulation

  • Quantitative biochemistry:

    • Measure surface expression of target channels using cell-surface biotinylation

    • Quantify protein-protein interactions through FRET or BRET approaches

    • Correlate interaction strength with functional effects

These approaches provide complementary data to differentiate KCNV1's direct modulatory effects from secondary consequences of its expression .

What are the best practices for implementing experimental and quasi-experimental designs in KCNV1 research?

When designing rigorous studies of KCNV1 function, researchers should consider these best practices:

  • Randomized controlled trial approaches:

    • Incorporate randomization when assigning experimental conditions

    • Include appropriate control groups (e.g., cells expressing target channels without KCNV1)

    • Blind analysis where possible to minimize bias

  • Quasi-experimental designs:

    • Consider interrupted time series (ITS) designs for studying temporal aspects of KCNV1 modulation

    • Implement pre-post designs with non-equivalent control groups when randomization isn't feasible

    • Use stepped wedge designs for gradual implementation of experimental interventions

  • Statistical considerations:

    • Determine appropriate sample sizes through power analysis

    • Account for multiple comparisons when testing numerous KCNV1 variants

    • Apply appropriate statistical tests based on data distribution characteristics

  • Replication strategies:

    • Perform independent biological replicates

    • Validate key findings using complementary methodological approaches

    • Consider multi-laboratory validation for critical discoveries

These experimental design considerations enhance the rigor and reproducibility of KCNV1 research, particularly in complex systems where multiple variables may influence outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.