Recombinant Human PQ-loop repeat-containing protein 1 (PQLC1)

Shipped with Ice Packs
In Stock

Description

Domain Architecture

  • PQ-loop domains: Contains two conserved PQ-loop motifs (Proline-Glutamine repeat regions), critical for membrane protein folding and substrate recognition .

  • Transmembrane topology: Predicted to span the membrane with multiple transmembrane segments, similar to cystinosin (CTNS), a lysosomal cystine transporter .

Isoforms and Splicing Variants

Multiple transcript variants have been identified in primates, including rhesus macaques, with isoforms differing in exon composition and protein length :

AccessionLength (aa)DescriptionSource
NP_001252651.1272Full-length isoform X1Macaca mulatta
XP_014977706.1254Truncated isoform X1 (missing N-term)Macaca mulatta
Q5M880271Rat ortholog (His-tagged)Rattus norvegicus

Production and Expression Systems

Recombinant PQLC1 is synthesized via heterologous expression systems, with optimization for solubility and functional activity:

SystemTagPurificationYieldApplication
E. coliN-terminal HisIMAC chromatographyHigh (mg/L range)Structural studies, antibody screening
Mammalian cellsC-terminal DYKDDDDKAffinity chromatography (DYK tag)ModerateFunctional transport assays

Key Challenges:

  • Low solubility: Requires solubility-enhancing tags (e.g., His, DYKDDDDK) .

  • Conformational stability: Proper membrane insertion is critical for functional studies .

Functional Insights and Hypothesized Roles

While direct evidence for PQLC1’s function remains limited, homology to characterized PQ-loop proteins suggests potential roles:

Transport Activity

PQLC1 shares structural similarity with:

  • Cystinosin (CTNS): Lysosomal cystine exporter implicated in cystinosis .

  • PQLC2: Lysosomal cationic amino acid (CAA) transporter (lysine, arginine) .

  • Ypq1/2/3: Yeast vacuolar CAA exporters .

Proposed Mechanism:

  • Electrogenic transport: Likely mediated by conformational changes in PQ motifs, enabling substrate translocation across membranes .

  • pH-dependent activation: Enhanced transport at acidic pH, akin to lysosomal conditions .

Disease Association

No direct link to human diseases has been established, but PQLC1’s homology to cystinosin and PQLC2 implies potential roles in lysosomal storage disorders or amino acid metabolism .

Research Applications and Tools

PQLC1 is utilized in structural and functional studies, supported by specialized reagents:

Antibodies

TypeImmunogenCross-reactivityApplication
Polyclonal (PA5-62453)ETLGFLAVLT EAMLGVPQLY RNHRHQSTEG MSIKMVLMWT SGDAFKTAYF LLKGAPLQFS VCGLLQVLVD LAILGQAYAF ARHPQKPAPH AVHPTGTKMouse (88%), Rat (90%)Western blot, IHC

Recombinant Proteins

  • Full-length His-tagged PQLC1: Used in ligand-binding assays and crystallography .

  • DYKDDDDK-tagged variants: Facilitate pulldown experiments to study protein interactions .

Gaps and Future Directions

  • Functional validation: Direct evidence of transport activity (e.g., electrophysiological assays) is lacking.

  • Substrate specificity: Unresolved whether PQLC1 transports CAAs, cystine, or other substrates.

  • Therapeutic potential: Further studies are needed to explore its role in lysosomal diseases or metabolic regulation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SLC66A2; PQLC1; Solute carrier family 66 member 2; PQ-loop repeat-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PQLC1
Target Protein Sequence
MEAEGLDWLLVPLHQLVSWGAAAAMVFGGVVPYVPQYRDIRRTQNADGFSTYVCLVLLVA NILRILFWFGRRFESPLLWQSAIMILTMLLMLKLCTEVRVANELNARRRSFTAADSKDEE VKVAPRRSFLDFDPHHFWQWSSFSDYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVL TEAMLGVPQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQFSVCGLLQVLV DLAILGQAYAFARHPQKPAPHAVHPTGTKAL
Uniprot No.

Target Background

Database Links

HGNC: 26188

KEGG: hsa:80148

STRING: 9606.ENSP00000380880

UniGene: Hs.288284

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is PQLC1 and what molecular properties characterize this protein?

PQLC1 (PQ-loop repeat-containing protein 1) is a human protein belonging to the PQ-loop family, characterized by structural motifs found in certain membrane proteins. Based on current research, PQLC1 shows significant expression in various ocular tissues, including retina/RPE, sclera, choroid, optic nerve, and cornea in both fetal and adult tissues .

While its exact biological function remains under investigation, PQLC1 may potentially function similarly to Solute Carrier (SLC) proteins. Current research suggests that PQLC1 could be considered an "SLC-like" protein, as it shares characteristics with membrane transporters that facilitate solute movement across biological membranes . This classification is supported by structural analysis using hidden Markov model (HMM) comparison methods that identify locally similar regions between known SLC proteins and potential SLC-like candidates .

Methodological consideration: When investigating PQLC1 function, researchers should employ comparative sequence analysis alongside functional transport assays to determine substrate specificity and transport mechanisms.

What is the expression profile of PQLC1 across human tissues?

PQLC1 demonstrates a specific pattern of expression across ocular tissues, with particularly strong expression in fetal developmental tissues. The table below summarizes expression data from current research:

Tissue TypeAdult Expression (p-value)Fetal Expression (p-value)
Retina/RPEp = 0.0037p = 1.0×10^-15
Sclerap = 1.0×10^-15p = 1.0×10^-15
ChoroidNot specifiedp = 1.0×10^-15
Optic NerveNot specifiedp = 1.0×10^-15
Corneap = 0.0002p = 1.0×10^-15

This expression pattern suggests a potential role for PQLC1 in both ocular development and the maintenance of adult eye structure and function . The strong statistical significance of expression in fetal tissues (p = 1.0×10^-15) indicates a particularly important role during development.

Methodological consideration: RNA-seq is an effective technique for quantifying PQLC1 expression across tissues, with polyA selection protocols showing better performance for detecting protein-coding transcripts compared to rRNA depletion methods .

How is PQLC1 genetically regulated and what epigenetic factors influence its expression?

Research has identified significant epigenetic regulation of PQLC1 through DNA methylation patterns. A genome-wide methylation study examining umbilical cord tissue DNA found that differential methylation at CpG sites associated with PQLC1 correlates with early-onset myopia risk in children .

Specifically, myopic children showed reduced methylation at PQLC1-associated CpG sites compared to non-myopic children, suggesting that epigenetic changes may affect PQLC1 expression levels and potentially contribute to myopia development . This epigenetic regulation appears to be established in utero, highlighting the importance of prenatal factors in determining PQLC1 expression patterns.

Methodological consideration: When studying PQLC1 regulation, researchers should employ both DNA methylation analysis (e.g., bisulfite sequencing) and gene expression quantification methods to establish correlations between epigenetic modifications and transcriptional outcomes.

What experimental models are most suitable for studying PQLC1 function?

Based on current research findings, several experimental models show promise for investigating PQLC1:

  • Human ocular tissue models: Both fetal and adult ocular tissues express PQLC1, making primary cell cultures or organoids derived from human eye tissues valuable models . Retinal pigment epithelium (RPE) cells, corneal epithelial cells, and scleral fibroblasts would be particularly relevant.

  • Mouse models: PQLC1 expression has been detected in mouse sclera (p = 1.50×10^-1), though this finding did not reach statistical significance . Nevertheless, mouse models of myopia may provide insights into PQLC1's role in ocular development and refractive error.

  • Cell line models: Established cell lines expressing endogenous or recombinant PQLC1 can be useful for mechanistic studies. Human cell lines derived from ocular tissues would be most physiologically relevant.

Experimental design considerations:

  • For recombinant expression, mammalian expression systems are likely optimal given PQLC1's human origin and potential post-translational modifications

  • CRISPR-Cas9 gene editing can be employed to create knockout or knockin models to study PQLC1 function

  • Form-deprivation or lens-induced myopia models in animals can be valuable for studying PQLC1's role in refractive error development

How is PQLC1 implicated in ocular disease mechanisms?

Current research has established a potential link between PQLC1 and early-onset myopia development through epigenetic mechanisms . The GUSTO birth cohort study identified differential methylation at PQLC1-associated CpG sites in umbilical cord tissue from children who later developed myopia by age 3 compared to non-myopic controls .

This methylation pattern, established in utero, may influence PQLC1 expression during critical periods of eye development. The consistent expression of PQLC1 in both human and mouse cornea and sclera tissues further supports its potential role in ocular development and refractive error determination .

The mechanism by which altered PQLC1 expression contributes to myopia may involve:

  • Modified solute transport affecting scleral extracellular matrix composition

  • Altered signaling pathways regulating eye growth

  • Changes in cellular responses to visual input during critical developmental periods

These hypotheses remain to be fully tested through functional studies of PQLC1 in relevant models.

What current contradictions or gaps exist in PQLC1 research literature?

Several significant knowledge gaps and research challenges persist in the PQLC1 field:

  • Functional characterization: While PQLC1 is expressed in ocular tissues and may function as a transporter similar to SLC proteins, its specific substrates and transport mechanisms remain unidentified . Current classification methods based on sequence similarity and structural prediction require validation through functional assays.

  • Mouse model discrepancies: Although PQLC1 expression was detected in mouse sclera, the finding did not reach statistical significance (p = 1.50×10^-1) . This contrasts with its significant expression in human scleral tissue, suggesting potential species differences that researchers must consider when designing animal studies.

  • Mechanistic link to myopia: While epigenetic changes in PQLC1 are associated with myopia development, the causal relationship and molecular pathway connecting PQLC1 function to refractive error remain undefined .

  • Therapeutic potential: Whether PQLC1 represents a viable therapeutic target for myopia prevention or treatment is unknown and requires further investigation of its biological function and disease relevance.

Research recommendation: A multi-modal approach combining structural biology, transport assays, and genetic models will be necessary to resolve these contradictions and establish PQLC1's biological role.

What strategies are recommended for recombinant expression and purification of human PQLC1?

For optimal recombinant expression of human PQLC1, researchers should consider the following approach:

  • Expression system selection:

    • Mammalian expression systems (HEK293, CHO cells) are recommended for proper folding and post-translational modifications

    • Insect cell systems (Sf9, High Five) represent a viable alternative with higher yield potential

    • Bacterial systems are generally not recommended for membrane proteins like PQLC1 due to potential misfolding

  • Expression construct design:

    • Include a cleavable affinity tag (His6, FLAG, etc.) for purification

    • Consider fusion partners that enhance membrane protein expression (e.g., GFP, MBP)

    • Include a TEV or PreScission protease site for tag removal

    • Codon optimization for the selected expression system

  • Expression conditions:

    • For mammalian systems, transient transfection often yields sufficient protein for initial characterization

    • For larger-scale production, stable cell line generation is recommended

    • Temperature optimization (typically 30-37°C) can improve proper folding

  • Purification strategy:

    • Membrane isolation via ultracentrifugation

    • Solubilization using mild detergents (DDM, LMNG, or GDN)

    • Affinity chromatography followed by size exclusion chromatography

    • Consider nanodiscs or amphipols for stabilization in solution

Quality control: SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) is recommended to assess sample homogeneity and oligomeric state.

What techniques are most effective for analyzing PQLC1 transport function?

Since PQLC1 potentially functions as a solute transporter similar to SLC proteins , the following methodological approaches are recommended for functional characterization:

  • Substrate identification strategies:

    • Untargeted metabolomics comparing PQLC1-expressing vs. control cells or vesicles

    • Radioligand binding assays with candidate substrates

    • Fluorescent substrate analogs combined with microscopy or plate reader assays

    • Electrophysiological recordings if transport is electrogenic

  • Transport assay systems:

    • Proteoliposomes with purified PQLC1 for direct transport measurements

    • Cell-based uptake assays using radiolabeled or fluorescent substrates

    • Fluorescent sensor-based assays for real-time measurements

    • Vesicle-based transport assays from PQLC1-expressing cells

  • Kinetic characterization:

    • Concentration-dependent uptake assays to determine Km and Vmax

    • Time-course experiments to establish transport rates

    • pH and ion dependence studies to determine transport mechanism

    • Inhibitor studies to identify transport modulators

Data analysis recommendation: Employ multiple complementary assay formats and controls to distinguish between direct transport, facilitated diffusion, and indirect effects on substrate levels.

How can researchers effectively apply RNA-seq to study PQLC1 expression in disease contexts?

RNA sequencing represents a powerful approach for investigating PQLC1 expression in normal development and disease states. Based on current methodological research, the following recommendations can optimize RNA-seq for PQLC1 studies:

Quality control metrics: Assess alignment rates (target >80%), exonic mapping rates (target >70% for PA protocols), and coverage uniformity across the PQLC1 transcript .

Protocol ComparisonPolyA SelectionrRNA Depletion
Exon mapping75.2-76.9%52.0-72.6%
Intronic mapping~21.0%~33.8%
Features detected~30,205~32,830
Protein coding gene quantificationSuperiorAdequate
Non-coding RNA detectionLimitedSuperior

This comparative data demonstrates the trade-offs researchers must consider when selecting RNA-seq methodology for PQLC1 studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.