Recombinant Human PQ-loop repeat-containing protein 2 (PQLC2)

Shipped with Ice Packs
In Stock

Description

Transport Mechanism and Substrate Specificity

PQLC2 operates as a uniporter, transporting CAAs (arginine, lysine, histidine) bidirectionally across lysosomal membranes without coupling to the proton gradient . Its activity is regulated by substrate availability and conformational states .

Substrate Interactions:

SubstrateTransport ModeRegulatory EffectSource
ArginineUniporterInhibits transport when in trans compartment (cytosol)
LysineUniporterNo inhibitory effect
HistidineUniporterNo inhibitory effect
Cysteamine-cystine adductUniporterCritical for cystinosis treatment

Mechanistic Insight: Arginine binding to PQLC2’s cytoplasmic gate facilitates closure, modulating transport kinetics . This substrate-dependent gating suggests a potential signaling mechanism.

Role in Cellular Signaling and Lysosome Function

PQLC2 recruits the C9orf72-SMCR8-WDR41 complex to lysosomes under nutrient scarcity, acting as a transceptor (transporter + receptor) . This complex regulates lysosome biogenesis, autophagy, and mTORC1 signaling .

Key Signaling Pathways:

  • mTORC1 Activation: PQLC2 KO cells show impaired S6K phosphorylation in response to CAAs, indicating disrupted nutrient sensing .

  • Autophagy Modulation: PQLC2 interacts with the C9orf72 complex to regulate lysosomal degradation pathways .

Research Findings and Key Mutations

Structural and mutagenesis studies have delineated critical residues and domains:

Table 1: Critical Residues in WDR41’s TIP Motif for PQLC2 Binding

ResidueMutationEffect on PQLC2 InteractionSource
F366F366AAbolished
F367F367AAbolished
N368N368AAbolished
M369M369AAbolished
W370W370AAbolished
F372F372AAbolished

Table 2: PQLC2 Mutations and Functional Consequences

MutationTransport ActivityWDR41 Complex RecruitmentSource
P55L (PQ motif)ReducedReduced
P201L (PQ motif)ReducedReduced
P55L + P201LAbolishedAbolished
Dileucine motifs (AA)Mislocalized to plasma membraneReduced interaction

Key Observations:

  • Conformational Dependency: The inward-facing PQLC2 state exposes a cavity that binds WDR41’s TIP motif .

  • Conservation: The TIP motif (TGFFNMWGFG) is highly conserved across species, underscoring its functional importance .

Clinical and Therapeutic Relevance

PQLC2 is pivotal in cystinosis treatment. It transports cysteamine-cystine adducts out of lysosomes, preventing cystine accumulation . Gene silencing traps this intermediate, worsening disease progression .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC66A1; PQLC2; Lysosomal amino acid transporter 1 homolog; PQ-loop repeat-containing protein 2; Solute carrier family 66 member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PQLC2
Target Protein Sequence
MVWKKLGSRNFSSCPSGSIQWIWDVLGECAQDGWDEASVGLGLISILCFAASTFPQFIKA YKTGNMDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADLVMLTLYFYYK FRTRPSLLSAPINSVLLFLMGMACATPLLSAAGPVAAPREAFRGRALLSVESGSKPFTRQ EVIGFVIGSISSVLYLLSRLPQIRTNFLRKSTQGISYSLFALVMLGNTLYGLSVLLKNPE EGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRRSTAASELEPLLPS
Uniprot No.

Target Background

Function
PQ-loop repeat-containing protein 2 (PQLC2) is an amino acid transporter that specifically mediates the pH-dependent export of the cationic amino acids arginine, histidine, and lysine from lysosomes.
Gene References Into Functions
  1. PQLC2 and Ypq1-3 proteins are lysosomal/vacuolar exporters of CAAs, suggesting that small-molecule transport is a conserved feature of the PQ-loop protein family. PMID: 23169667
Database Links

HGNC: 26001

OMIM: 614760

KEGG: hsa:54896

STRING: 9606.ENSP00000364295

UniGene: Hs.647620

Protein Families
Laat-1 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the basic function of PQLC2 in lysosomes?

    PQLC2 serves dual roles as both a transporter and receptor-like protein ("transceptor") in lysosomes. Primarily, it functions as a lysosomal cationic amino acid transporter that mediates the efflux of arginine, lysine, and histidine from lysosomes into the cytoplasm . This transport activity is uncoupled from the lysosomal pH gradient, allowing bidirectional cationic amino acid transport across the organelle membrane . Biochemical and electrophysiological studies have demonstrated that PQLC2 operates in a uniporter mode rather than as a coupled transporter, making it distinct from many other lysosomal transporters .

  • How does PQLC2 interact with the C9orf72 complex?

    PQLC2 recruits a heterotrimeric protein complex containing C9orf72, SMCR8, and WDR41 to the surface of lysosomes in response to amino acid scarcity . This interaction occurs through a direct binding between PQLC2 and WDR41, which serves as the mediator for complex recruitment . The interaction is mediated by a short peptide motif (known as the PIP motif) in a flexible loop that extends from the WDR41 β-propeller and inserts into a cavity presented by the inward-facing conformation of PQLC2 . Pull-down assays with recombinant proteins have confirmed this direct interaction, showing that a GST-PIP fusion protein selectively interacts with purified PQLC2-FLAG .

  • What experimental approaches are commonly used to study PQLC2 localization?

    Researchers typically employ several techniques to study PQLC2 localization:

    • Immunofluorescence microscopy: Using antibodies against PQLC2 and lysosomal markers (e.g., LAMP1) to visualize colocalization .

    • Expression of tagged PQLC2: Transfection of cells with FLAG-tagged or GFP-tagged PQLC2 constructs .

    • CRISPR-Cas9 knockout models: Generation of PQLC2 knockout cell lines to confirm specificity of localization patterns .

    • Co-transfection studies: Expressing PQLC2 with components of the C9orf72 complex to examine recruitment under different nutrient conditions .

    These methods typically involve visualization in both normal and amino acid starvation conditions to observe the dynamic recruitment of the C9orf72 complex to lysosomes.

Advanced Research Questions

  • How do conformational changes in PQLC2 regulate its interaction with the C9orf72 complex?

    PQLC2 undergoes conformational changes related to its transport function that directly affect its ability to interact with WDR41 and recruit the C9orf72 complex. The PQ motifs in transmembrane helices 1 and 5 of PQLC2 function as hinges that support conformational changes required for substrate transport . Evidence suggests that the inward-facing conformation of PQLC2 is crucial for WDR41 binding.

    Experimental validation has shown that proline-to-leucine mutations at these PQ motif sites (P55L, P201L) reduce or completely abolish interactions with the WDR41 TIP . The double P55L + P201L mutation prevents recruitment of the WDR41-SMCR8-C9orf72 complex despite proper lysosomal localization of the mutant PQLC2 .

    This provides a mechanistic model for PQLC2's transceptor properties, where substrate transport and signaling activities are linked through specific conformational states of the alternating access transport model .

  • What regulates the PQLC2-WDR41 interaction in response to amino acid availability?

    The interaction between PQLC2 and WDR41 is negatively regulated specifically by the cationic amino acids that PQLC2 transports (arginine, lysine, and histidine) . This regulation appears to be particularly sensitive to arginine levels. Electrophysiological studies have revealed that:

    • Arginine, but not lysine or histidine, in the discharge ("trans") compartment impairs PQLC2 transport .

    • Arginine induces a selective inward rectification of the PQLC2 current, regardless of which amino acid is carrying the current .

    • Cytosolic arginine reduces the PQLC2 current through what appears to be a trans-inhibition mechanism .

    Kinetic modeling suggests that arginine accelerates the closing of PQLC2's cytosolic gate, which could influence the availability of the WDR41-binding site . This creates a signaling model where PQLC2 transduces nutrient status through opposing effects of lysosomal membrane potential and cytosolic arginine on its conformational state .

  • How can researchers distinguish between PQLC2's transport function and its signaling role experimentally?

    Distinguishing between PQLC2's dual functions can be accomplished through:

    1. Mutational studies: Generate transport-deficient PQLC2 mutants (e.g., P55L/P201L) that maintain lysosomal localization but cannot recruit the C9orf72 complex .

    2. Electrophysiological approaches:

      • Patch-clamp recordings to measure PQLC2 currents under different amino acid conditions

      • Measurement of charge/substrate ratio and reversal potentials to characterize transport properties

    3. Binding assays:

      • GST pull-down experiments with recombinant PIP motif to isolate direct binding interactions

      • Immunoprecipitation assays to assess protein complex formation under different nutrient conditions

    4. Subcellular localization studies:

      • Compare wild-type PQLC2 with plasma membrane-localized PQLC2 mutants (requiring mutation of two distinct dileucine motifs in the cytoplasmic C-terminus)

      • Assess interaction with WDR41-PIP in different cellular compartments

    These complementary approaches allow researchers to parse the mechanistic details of how transport activity influences signaling functions.

  • What methodologies are most effective for studying PQLC2-dependent recruitment of the C9orf72 complex in vitro?

    Effective methodologies include:

    1. CRISPR-Cas9 knockout systems: Generate PQLC2 knockout cell lines to demonstrate the requirement for PQLC2 in C9orf72 complex recruitment to lysosomes .

    2. Fluorescence microscopy with amino acid starvation protocols:

      • Starve cells of amino acids to trigger recruitment

      • Perform immunofluorescence for C9orf72, SMCR8, WDR41 and lysosomal markers

      • Quantify colocalization using image analysis software

    3. Protein-protein interaction assays:

      • Immunoprecipitation followed by Western blotting

      • Pull-down assays with recombinant proteins

      • Yeast two-hybrid screening to identify interaction domains

    4. Selective amino acid supplementation experiments:

      • Test the effects of specifically adding back arginine, lysine, or histidine after starvation

      • Monitor changes in C9orf72 complex localization

    5. Live-cell imaging with fluorescently-tagged proteins:

      • Track the dynamic recruitment process in real-time

      • Measure kinetics of association and dissociation under different conditions

  • What is the role of PQLC2 in disease mechanisms, particularly in cancer progression?

    PQLC2 has been implicated in multiple disease mechanisms:

    1. Cancer progression: PQLC2 appears to function as an oncogene in gastric cancer (GC). Studies have shown that:

      • Both PQLC2 mRNA and protein are overexpressed in GC tissues, particularly in diffuse-type GC

      • Overexpression of PQLC2 promotes cell growth, anchorage independence, and tumor formation in nude mice through activation of MEK/ERK1/2 and PI3K/AKT signaling pathways

      • PQLC2 knockdown causes growth arrest and cell death in cancer cells and suppresses tumor growth in mouse xenograft models

    2. Neurological diseases: The C9orf72 complex that PQLC2 interacts with is implicated in neurological disorders, particularly in amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD)

    3. Lysosomal storage disorders: PQLC2's transport activity is essential for drug treatment of the rare disease cystinosis

    Research approaches to study these disease connections include gene expression profiling, pathway analysis, patient-derived cell lines, and animal models with modified PQLC2 expression.

  • How can structural predictions of PQLC2 inform experimental design?

    Structural prediction methods provide valuable insights that can guide experimental design for PQLC2 research:

    1. Computational methods commonly used include:

      • HHpred for protein homology detection and structure prediction via HMM-HMM comparison

      • MODELER for comparative protein structure modeling

      • GalaxyTongDock for protein-protein docking analysis in an ab initio asymmetric fashion

      • UCSF Chimera for visualization and 3D analysis

    2. Applications to experimental design:

      • Identifying key residues for site-directed mutagenesis

      • Predicting interaction interfaces between PQLC2 and WDR41

      • Designing truncation constructs that maintain structural integrity

      • Understanding the conformational changes associated with transport

    For example, structural predictions identified the PIP motif in WDR41 and the cavity in the inward-facing conformation of PQLC2 as critical for their interaction, which was subsequently validated through experimental approaches .

  • What are the technical challenges in producing functional recombinant PQLC2 for in vitro studies?

    Producing functional recombinant PQLC2 presents several technical challenges:

    1. Expression systems:

      • HEK293FT cells are commonly used for mammalian expression

      • Xenopus oocytes have been utilized for electrophysiological studies

    2. Protein tagging strategies:

      • FLAG tags or GFP fusions can be used for detection and purification

      • Tag position is critical to maintain functionality

    3. Maintaining proper folding and membrane integration:

      • PQLC2 is a multi-pass transmembrane protein with PQ-loop domains

      • The PQ motifs in transmembrane helices 1 and 5 are critical for conformational changes

    4. Preservation of functional interactions:

      • Mutations in the PQ motifs (P55L, P201L) abolish transport activity and WDR41 binding

      • Dileucine motifs in the cytoplasmic C-terminus are important for lysosomal targeting

    5. Reconstitution systems:

      • Liposome reconstitution for transport assays

      • Membrane preparation protocols for maintaining native conformations

    Researchers must carefully consider these factors when designing constructs and expression systems for recombinant PQLC2 studies.

  • How does the arginine-selective modulation of PQLC2 differ from other amino acid sensing mechanisms in the lysosome?

    PQLC2's arginine-selective modulation represents a unique amino acid sensing mechanism compared to other lysosomal nutrient sensing pathways:

    1. Comparison with SLC38A9-mTORC1 pathway:

      • SLC38A9 is another lysosomal amino acid transporter that associates with mTORC1 regulatory machinery

      • SLC38A9 communicates the abundance of arginine, lysine, and leucine to the mTORC1 signaling pathway

      • PQLC2, in contrast, signals to the C9orf72 complex independently of mTORC1

    2. Mechanism of arginine sensing:

      • PQLC2 shows arginine-selective modulation through a trans-inhibition mechanism

      • Arginine, but not other substrates (lysine, histidine), in the discharge compartment impairs PQLC2 transport

      • Arginine specifically induces inward rectification of the PQLC2 current

    3. Gate-tuning mechanism:

      • Kinetic modeling suggests arginine accelerates the closing of PQLC2's cytosolic gate

      • This creates a model where PQLC2 transduces nutrient status through opposing effects of lysosomal membrane potential and cytosolic arginine on its conformational state

    4. Uniporter versus coupled transport:

      • PQLC2 operates as a uniporter uncoupled from the lysosomal proton gradient

      • Many other lysosomal transporters function as H+-coupled symporters or antiporters

    This unique mechanism provides targeted sensitivity to arginine levels that may have evolved to meet specific cellular signaling needs.

Data Tables and Methods

  • What experimental protocols should be followed for studying PQLC2-mediated recruitment of the C9orf72 complex?

    Table 1: Experimental Protocols for PQLC2-C9orf72 Complex Studies

    TechniqueMaterialsProtocol StepsKey Controls
    ImmunofluorescenceAnti-C9orf72, anti-SMCR8, anti-WDR41, anti-LAMP1 antibodies1. Starve cells for amino acids (EBSS medium, 2h)
    2. Fix with 4% PFA
    3. Permeabilize with 0.1% Triton X-100
    4. Block with 5% BSA
    5. Incubate with primary antibodies
    6. Detect with fluorescent secondary antibodies
    1. PQLC2 knockout cells
    2. Unstarved cells
    3. Single antibody controls
    4. Secondary antibody only
    Co-immunoprecipitationPQLC2-FLAG, WDR41-GFP constructs, anti-FLAG/GFP beads1. Transfect cells with constructs
    2. Lyse in buffer with 1% NP-40
    3. Clear lysate by centrifugation
    4. Incubate with antibody-conjugated beads
    5. Wash and elute
    6. Analyze by Western blot
    1. Empty vector controls
    2. Irrelevant protein-FLAG
    3. IgG control beads
    GST pull-downGST-PIP fusion proteins, PQLC2-FLAG1. Express and purify GST-PIP
    2. Immobilize on glutathione beads
    3. Incubate with cell lysates containing PQLC2-FLAG
    4. Wash and elute
    5. Detect by Western blot
    1. GST alone
    2. Mutant PIP motif
    3. Unrelated protein-FLAG
    Subcellular fractionationLysosome isolation kit1. Homogenize cells in isotonic buffer
    2. Differential centrifugation
    3. Isolate lysosomal fraction
    4. Analyze proteins by Western blot
    1. Marker proteins for different organelles
    2. Whole cell lysate

    This table provides a comprehensive overview of the key experimental approaches for studying the PQLC2-mediated recruitment of the C9orf72 complex, including essential controls to ensure specificity and reproducibility.

  • What are the specific domains and key residues of PQLC2 important for its function and interactions?

    Table 2: Key Domains and Residues of PQLC2

    Domain/MotifPositionFunctionEffect of MutationReference
    PQ motif 1TM1 (P55)Conformational hinge for transportP55L reduces transport and WDR41 binding
    PQ motif 2TM5 (P201)Conformational hinge for transportP201L reduces transport and WDR41 binding
    Double PQ mutationP55L + P201LCritical for inward-facing conformationAbolishes WDR41 binding and C9orf72 complex recruitment
    Dileucine motif 1C-terminal (cytoplasmic)Lysosomal targeting signalSingle mutation insufficient for plasma membrane mistargeting
    Dileucine motif 2C-terminal (cytoplasmic)Lysosomal targeting signalBoth dileucine motifs must be mutated for plasma membrane localization
    WDR41 binding siteCavity in inward-facing conformationInteraction with WDR41 PIP motifBlocked by substrate binding/outward conformation
    Substrate binding siteCentral cavityBinding of arginine, lysine, histidineArginine in trans compartment causes selective inward rectification

    This table summarizes the critical structural elements of PQLC2 that have been identified through experimental studies, highlighting the dual importance of certain residues for both transport activity and protein-protein interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.