Recombinant Human PRA1 family protein 3 (ARL6IP5)

Shipped with Ice Packs
In Stock

Description

Biological Functions

ARL6IP5 regulates multiple pathways:

Apoptosis Induction

  • Activates caspase-8 and caspase-9 pathways, promoting programmed cell death .

  • Enhances neuronal glutathione levels, offering neuroprotection against oxidative stress .

Migration and Invasion Suppression

  • Inhibits matrix metalloproteinases (MMPs):

    • Reduces MMP-2 activity by downregulating integrin αvβ3 signaling .

    • Suppresses MMP-9 expression by blocking CCR5 membrane trafficking .

Glutamate Transport Modulation

  • Binds to EAAC1, reducing glutamate uptake in a PKC-dependent manner .

Role in Cancer

Cancer TypeKey Findings
Esophageal Squamous Cell Carcinoma (ESCC)- ARL6IP5 expression is downregulated in tumors vs. normal tissues .
- Overexpression inhibits metastasis by 60% and correlates with improved survival .
Ovarian Carcinoma- Reduces cisplatin resistance by suppressing DNA repair pathways and enhancing apoptosis .

Neurological Implications

  • Knockout mice exhibit enhanced motor/spatial learning and memory due to increased neuronal glutathione .

Applications in Biomedical Research

  • Mechanistic Studies: Elucidating apoptosis, metastasis, and oxidative stress pathways .

  • Therapeutic Development: Potential target for cancers with ARL6IP5 downregulation .

  • Diagnostic Tools: Used in ELISA kits (e.g., CSB-CF701123PI) to quantify protein levels .

Future Directions

Ongoing research aims to:

  • Clarify ARL6IP5’s role in drug resistance (e.g., cisplatin) .

  • Develop gene therapy approaches to restore ARL6IP5 expression in cancers .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will then prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
ARL6IP5; DERP11; JWA; PRA2; PRAF3; HSPC127; PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5; Cytoskeleton-related vitamin A-responsive protein; Dermal papilla-derived protein 11; GTRAP3-18; Glutamate transporter EAAC1-interacting protein; JM5; Prenylated Rab acceptor protein 2; Protein JWa; Putative MAPK-activating protein PM27
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
ARL6IP5
Target Protein Sequence
MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT DYISKVKE
Uniprot No.

Target Background

Function
Regulates intracellular concentrations of taurine and glutamate. Negatively modulates SLC1A1/EAAC1 glutamate transport activity by reducing its affinity for glutamate in a PKC activity-dependent manner. Plays a role in the retention of SLC1A1/EAAC1 in the endoplasmic reticulum.
Gene References Into Functions
  1. These data demonstrate that JWA suppressed the migration/invasion of breast carcinoma cells by downregulating the expression of CXCR4, suggesting that JWA may have prognostic and therapeutic potential in patients with breast cancer. PMID: 29658570
  2. Increased RNF185 expression facilitated GC cell migration in vitro and promoted GC metastasis in vivo by downregulating JWA expression. PMID: 29481911
  3. Our results demonstrate that JWA is a novel negative regulator of HER2 expression...in HER2-positive gastric cancer cells. PMID: 27167206
  4. Protective effect of JWA against paraquat neurotoxicity involves regulation of the MEK/PI3K-Nrf2 axis. PMID: 28428137
  5. JWA and topoisomerase II alpha regulate each other in tumor cells arrested in G2/M. PMID: 26046674
  6. The JWA gene may regulate human breast cancer cells through the MAPK signaling pathway using different types of regulation. PMID: 25586271
  7. This review provides an overview of EAAC1-mediated GSH synthesis, its regulatory mechanisms by GTRAP3-18 in the brain, and a potential approach against neurodegeneration. PMID: 23109897
  8. JWA reverses cisplatin resistance via the CK2-XRCC1 pathway in human gastric cancer cells. PMID: 25476899
  9. Data demonstrate that JWA plays a crucial role in HCC progression and suggest JWA may be a potential prognostic biomarker and therapeutic target for HCC. PMID: 23169062
  10. A significant negative correlation between JWA and ILK in melanoma biopsies. PMID: 24064223
  11. Loss of JWA expression was strongly correlated with increased gastric cancer angiogenesis. PMID: 24072772
  12. JWA has an important role in ING4-regulated melanoma angiogenesis, and ING4/JWA/ILK are promising prognostic markers and may be used as anti-angiogenic therapeutic targets for melanoma. PMID: 24157826
  13. A combined effect of p53 with JWA as efficient prognostic indicators was found for the first time. PMID: 23285001
  14. JWA plays an important role in the occurrence and progression of human esophageal squamous cell carcinoma (ESCC) and that high expression level of JWA may predict a favorable prognosis in ESCC patients. PMID: 23461062
  15. JWA and XRCC1 protein levels were downregulated in gastric cancer lesions compared with adjacent noncancerous tissues; JWA and XRCC1 protein expressions in tumor are candidate prognostic markers and predictive factors for benefit from adjuvant platinum-based chemotherapy in resectable gastric carcinoma PMID: 22452940
  16. The gene polymorphisms at site 76 and GG/CT haploid type of JWA gene were associated with hypertension in workers exposed to high temperature. PMID: 22357531
  17. PRAF3 plays an important role in the regulation of tumor progression and metastasis and serves as a tumor suppressor in human ESCC. We propose that PRAF3 might be used as a potential therapeutic agent for human ESCC. PMID: 22433565
  18. JWA might play an important role in neoplastic transformation of HBE cells through regulation of p53 expression. PMID: 19080375
  19. All-trans retinoic acid increased JWA gene expression in human pulmonary artery smooth muscle cells. PMID: 16638297
  20. Results suggest that JWA can be regulated by oxidative stress and is actively involved in the signal pathways of oxidative stress in the cells. PMID: 15864752
  21. Data show that the JWA -76G-->C variant genotype may play an important role in transcription regulation of JWA gene and in the susceptibility to bladder cancer. PMID: 16331563
  22. JWA may function as a lineage-restricted gene during differentiation along the monocyte/macrophage-like or granulocytic pathway PMID: 16430862
  23. All-trans retinoic acid up-regulates JWA expression by stimulating the transcriptional activity of JWA gene promoter PMID: 16468075
  24. The JWA determined might function as a potential effective environmental responsive gene and actively participated in the process of B (a) P exposure associated with intracellular signal pathways of DNA damage and repair PMID: 16640902
  25. JWA participates in the signal pathways of H2O2 induced oxidative stress in K562 cells PMID: 16766476
  26. The effects of All Trans Retinoic Acid in regulating cellular proliferation and apoptosis may be mediated in part by JWA expression. PMID: 16922813
  27. JWA regulated-tumor cellular migration might involve MAPK cascades activation and F-actin cytoskeleton rearrangement mechanisms. PMID: 17336041
  28. Three novel functional genetic polymorphisms of JWA gene, -76C, 454A, and 723G, appear to contribute to the etiology of bladder cancer PMID: 17479401
  29. Single nucleotide polymorphisms of JWA were associated with enhanced risk of gastric cancer and esophageal squamous cell carcinoma in a Chinese population. PMID: 17479402
  30. The potentially functional genetic polymorphism 454CA of the JWA gene appears to contribute to the risk of multiple kinds of leukemia in a south Chinese population. PMID: 17479403
  31. These results show GTRAP3-18 to negatively and dominantly regulate cellular GSH content via interaction with EAAC1 at the plasma membrane. PMID: 17646425
  32. Expression of GTRAP3-18 delays the ER exit of EAAC1, as well as other members of the excitatory amino acid transporter family. PMID: 18167356
  33. This paper primarily focuses on PRAF2, but comparisons with PRAF3 are also provided. PMID: 16481131
  34. Protein expression is upregulated by methyl-beta-cyclodextrin and not by retinoic acid PMID: 12562531
  35. High conservation of protein and genomic organization amongst vertebrates PMID: 12119102

Show More

Hide All

Database Links

HGNC: 16937

OMIM: 605709

KEGG: hsa:10550

STRING: 9606.ENSP00000273258

UniGene: Hs.518060

Protein Families
PRA1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasm, cytoskeleton.

Q&A

What is ARL6IP5 and what are its alternative names in scientific literature?

ARL6IP5 (ADP-ribosylation factor-like protein 6-interacting protein 5) is also known by numerous alternative names across species and research contexts. In humans, it is sometimes called JWA, while in mice it's known as Addicsin, and in rats as GTRAP3-18 or JM4 . Additional nomenclature includes PRA1 family protein 3, Aip-5, Cytoskeleton-related vitamin A-responsive protein, Dermal papilla-derived protein 11, Glutamate transporter EAAC1-interacting protein, JM5, Prenylated Rab acceptor protein 2, Protein JWa, and Putative MAPK-activating protein PM27 . This protein belongs to the PRAF3 family due to its functionally large prenylated acceptor domain 1, which plays a crucial role in intracellular protein trafficking . When conducting literature searches or designing experiments, researchers should account for this nomenclature diversity to ensure comprehensive coverage of existing research.

How does ARL6IP5 expression vary in different physiological and pathological conditions?

ARL6IP5 expression demonstrates significant variation under different physiological and pathological conditions, particularly in the context of aging and neurodegenerative diseases. Research has consistently shown that ARL6IP5 levels decrease with age in normal brain tissue . In Parkinson's Disease (PD) patients, immunohistochemistry analysis of midbrain sections reveals substantially reduced ARL6IP5 signals compared to control samples . This reduction has been quantified through fluorescence intensity measurements, showing statistically significant differences between PD patients and healthy controls .

In experimental PD models, treatment with the neurotoxin 6-OHDA (at concentrations of 30, 40, and 50 μM for 30 days) leads to progressive reduction in ARL6IP5 protein levels while simultaneously increasing α-synuclein expression . Similarly, in cell culture models, stable overexpression of either wild-type α-synuclein or the PD-associated A53T mutant form results in decreased ARL6IP5 protein levels . This inverse relationship between α-synuclein and ARL6IP5 suggests potential regulatory mechanisms that may be relevant to PD pathophysiology.

What is the functional relationship between ARL6IP5 and autophagy?

ARL6IP5 functions as a positive regulator of autophagy, comparable in efficacy to established chemical inducers such as rapamycin, serum starvation, and methyl-β-cyclodextrin (MβCD) . In cellular experiments, overexpression of ARL6IP5 significantly increases autophagy markers, including autophagosome formation (visualized as puncta) and LC3B-II levels . Quantitatively, ARL6IP5 overexpression increases autophagy by approximately 150-177% compared to control conditions .

Conversely, siRNA-mediated knockdown of ARL6IP5 substantially inhibits autophagy, reducing it by approximately 45-51% . When ARL6IP5 knockdown is combined with α-synuclein overexpression, a synergistic inhibitory effect on autophagy is observed . Mechanistically, ARL6IP5 operates as a downstream autophagy regulator by preventing the ubiquitination and subsequent degradation of ATG12, a key component of the autophagy machinery . When autophagy is induced through various chemical inducers (serum starvation, rapamycin, MβCD, or trehalose), the knockdown of ARL6IP5 significantly attenuates the autophagy response, indicating its crucial role in the autophagy pathway regardless of the initial trigger .

What are the optimal antibodies and detection methods for studying ARL6IP5?

For effective detection of ARL6IP5 in experimental systems, researchers should consider using validated polyclonal or monoclonal antibodies with documented specificity. The ARL6IP5 Polyclonal Antibody raised in rabbit against recombinant human PRA1 family protein 3 (specifically amino acids 136-188) has been successfully used in multiple applications . This antibody demonstrates reactivity with human samples and can be utilized in various experimental techniques with the following recommended dilutions:

  • Immunohistochemistry (IHC): 1:20-1:200 dilution

  • Immunofluorescence (IF): 1:50-1:200 dilution

  • ELISA: Follow manufacturer recommendations for optimal dilution

For western blotting experiments, GAPDH serves as an appropriate loading control when quantifying ARL6IP5 expression levels . When performing immunohistochemistry on brain sections, successful detection of ARL6IP5 (visualized in red) has been achieved in both normal and Parkinson's Disease mid-brain sections with appropriate controls . For optimal results, protein G purification of antibodies (>95% purity) is recommended .

How should researchers design experiments to study ARL6IP5's role in autophagy?

When designing experiments to investigate ARL6IP5's role in autophagy, researchers should incorporate multiple complementary approaches to generate robust and reproducible results. A comprehensive experimental design should include:

  • Genetic manipulation strategies:

    • Overexpression using Flag-ARL6IP5 constructs (5 μg transfection for 36 hours in SH-SY5Y cells has shown effective results)

    • Knockdown using siRNA-mediated approaches targeting ARL6IP5

    • Appropriate vector-only controls for transfection experiments

  • Autophagy assessment methods:

    • Microscopic analysis of autophagosome formation using confocal microscopy to quantify puncta (n=25 cells per condition is a suitable sample size)

    • Western blot analysis of LC3B-I to LC3B-II conversion

    • Comparative analysis with standard autophagy inducers as positive controls, including:

      • Serum starvation (2 hours)

      • Rapamycin treatment (1 μM for 2 hours)

      • Methyl-β-cyclodextrin (MβCD) treatment (100 μM for 24 hours)

  • Statistical analysis approaches:

    • One-way ANOVA with post hoc Tukey test for multiple comparisons

    • Two-way ANOVA for factorial experimental designs

    • Multiple t-tests with two-stage linear step-up procedure when appropriate

    • Sample sizes of n=3 for biochemical assays and n=25 for cell imaging studies have provided sufficient statistical power in published research

What methodological approaches are effective for studying ARL6IP5 in neurodegenerative disease models?

Studying ARL6IP5 in neurodegenerative disease models requires carefully designed experimental approaches that capture both molecular mechanisms and functional outcomes. Effective methodological strategies include:

  • Cellular models of Parkinson's Disease:

    • Stable cell lines overexpressing wild-type α-synuclein or the A53T mutant form in SH-SY5Y neuroblastoma cells

    • Transient co-expression of ARL6IP5 and α-synuclein to assess protective effects

    • Toxicity assessment using LDH assay to quantify cell death in response to α-synuclein overexpression with or without ARL6IP5 modulation

  • Animal models of neurodegeneration:

    • 6-OHDA-treated mice as a model of Parkinson's Disease, with concentrations of 30-50 μM administered for 30 days

    • Transgenic mouse models expressing human α-synuclein

    • Age-dependent analysis to capture temporal changes in ARL6IP5 expression relative to disease progression

  • Human tissue analysis:

    • Immunohistochemistry of midbrain sections from Parkinson's Disease patients compared to age-matched controls

    • Quantification using fluorescence intensity measurements followed by statistical analysis using unpaired two-tailed Student's t-test

When implementing these approaches, researchers should incorporate appropriate controls and blinding procedures to minimize experimental bias, particularly when assessing neuroprotective effects or changes in protein expression levels.

How does ARL6IP5 influence α-synuclein pathology in Parkinson's Disease models?

ARL6IP5 demonstrates significant mitigating effects on α-synuclein pathology in cellular models of Parkinson's Disease through multiple complementary mechanisms. Experimental evidence indicates that ARL6IP5 overexpression can substantially reduce α-synuclein burden by enhancing autophagy-mediated clearance mechanisms .

In cellular toxicity assays, knockdown of ARL6IP5 exacerbates α-synuclein-induced cell death, with LDH assay results showing approximately 15% increased toxicity (p = 0.018, n = 6) compared to α-synuclein overexpression alone . Conversely, ARL6IP5 overexpression provides protection against α-synuclein-induced cytotoxicity .

ARL6IP5 also influences the phosphorylation status of key signaling molecules that are dysregulated by α-synuclein overexpression. For instance, α-synuclein reduces the phosphorylation of Mer (a receptor tyrosine kinase involved in cellular survival) to approximately 74% of control levels, whereas ARL6IP5 overexpression dramatically increases Mer phosphorylation (321%, p < 0.0001) . When co-expressed with α-synuclein, ARL6IP5 effectively restores normal phosphorylation patterns, suggesting normalization of disrupted signaling pathways .

What is the molecular mechanism behind ARL6IP5's neuroprotective effects?

The neuroprotective effects of ARL6IP5 in neurodegenerative conditions operate through a complex molecular mechanism centered on the enhancement of autophagy pathways. Research has identified the ARL6IP5/Rab1/ATG12 axis as a critical pathway mediating this neuroprotection . The key molecular mechanisms include:

  • ATG12 stabilization: ARL6IP5 physically interacts with ATG12 and prevents its ubiquitination, thereby inhibiting its degradation through the proteasome pathway . This stabilization of ATG12 protein levels is critical, as demonstrated in immunoblots showing increased levels of ATG5+ATG12 complex, free ATG12, and ATG5 in ARL6IP5-transfected cells compared to controls .

  • Autophagy induction: Through its effects on ATG12 and potentially other autophagy-related proteins, ARL6IP5 induces autophagy at levels comparable to established chemical inducers . This enhanced autophagy promotes the clearance of protein aggregates, particularly α-synuclein, which is a hallmark of Parkinson's Disease pathology .

  • Restoration of dysregulated signaling: ARL6IP5 counteracts the aberrant signaling patterns induced by α-synuclein overexpression, including normalization of phosphorylation levels of key signaling molecules . This restoration of normal cellular signaling contributes to increased cell survival and reduced neurodegeneration.

The molecular interactions between ARL6IP5 and the autophagy machinery highlight its potential as a therapeutic target for enhancing protein quality control mechanisms in neurodegenerative diseases characterized by protein aggregation.

How does ARL6IP5 expression change with aging and what are the implications for neurodegenerative diseases?

ARL6IP5 expression exhibits a significant age-dependent decline in brain tissue, which may have important implications for the development and progression of neurodegenerative diseases . Detailed analysis of brain samples has revealed several key patterns:

  • Age-related decline: Quantitative western blot analysis with densitometric measurements shows that ARL6IP5 protein levels progressively decrease with advancing age in wild-type brain tissue . This age-dependent reduction suggests that normal aging processes may naturally diminish one of the brain's protective mechanisms against protein aggregation.

  • Further reduction in disease states: In transgenic mouse models of Parkinson's Disease and in human Parkinson's Disease brain samples, ARL6IP5 levels are even further reduced compared to age-matched controls . Specifically, immunohistochemistry analysis of midbrain sections from Parkinson's Disease patients shows markedly decreased ARL6IP5 signals compared to control samples .

  • Correlation with disease models: In experimental models of Parkinson's Disease, including 6-OHDA-treated mice and cells stably expressing α-synuclein or its A53T mutant form, ARL6IP5 levels are inversely correlated with disease severity and α-synuclein accumulation . This relationship suggests a potential vicious cycle where initial reductions in ARL6IP5 may permit greater α-synuclein accumulation, which in turn further suppresses ARL6IP5 expression.

These findings have significant implications for understanding the pathogenesis of age-related neurodegenerative diseases. The natural decline of ARL6IP5 with aging may represent a loss of proteostatic defense mechanisms that normally protect against protein aggregation. This age-related vulnerability, combined with disease-specific factors that further reduce ARL6IP5 levels, may contribute to the late-life onset and progressive nature of conditions like Parkinson's Disease.

How does ARL6IP5 interact with and regulate the autophagy machinery?

ARL6IP5 exerts its regulatory effects on autophagy through specific interactions with key components of the autophagy machinery, particularly the ATG12-ATG5 conjugation system. Detailed biochemical analyses have revealed several important aspects of these interactions:

  • Direct interaction with ATG12: ARL6IP5 has been identified as an ATG12 interacting protein . This physical interaction appears to be critical for stabilizing ATG12 and preventing its degradation, as evidenced by increased levels of both free ATG12 and the ATG5+ATG12 conjugate in cells overexpressing ARL6IP5 .

  • Prevention of ATG12 ubiquitination: One of the key mechanisms by which ARL6IP5 regulates autophagy is by preventing the ubiquitination of ATG12, thereby protecting it from proteasomal degradation . This function effectively increases the availability of ATG12 for participation in autophagy processes.

  • Independence from upstream autophagy regulators: Experimental evidence suggests that ARL6IP5 functions as a downstream regulator in the autophagy pathway . When autophagy is induced through various mechanisms (serum starvation, rapamycin, MβCD, or trehalose), ARL6IP5 knockdown significantly attenuates the autophagy response, indicating its essential role regardless of the initial trigger .

The specific molecular interactions between ARL6IP5 and ATG12, including the domains involved and the structural basis for preventing ubiquitination, represent important areas for further investigation. Understanding these mechanistic details could provide insights for developing targeted interventions to enhance autophagy in disease states.

What are the comparative effects of ARL6IP5 overexpression versus standard autophagy inducers?

ARL6IP5 overexpression induces autophagy with efficiency comparable to established chemical inducers, but potentially through distinct mechanisms. Comparative studies have yielded the following insights:

  • Quantitative comparison of autophagy induction:

    Autophagy InducerTreatment ProtocolAutophagy Induction (% vs Control)Statistical Significance
    ARL6IP5 overexpression5 μg transfection for 36h150-177%p = 0.0005
    Serum starvation2 hoursComparable to ARL6IP5Not directly stated
    Rapamycin1 μM for 2 hoursComparable to ARL6IP5Not directly stated
    MβCD100 μM for 24 hoursComparable to ARL6IP5Not directly stated
  • Autophagosome formation: Confocal microscopy analysis of autophagy puncta formation shows that ARL6IP5 overexpression induces significant increases in autophagosome numbers, comparable to the effects seen with standard chemical inducers . Quantification across approximately 25 cells per condition confirms this robust autophagy-inducing effect .

  • LC3B conversion: Western blot analysis of LC3B-I to LC3B-II conversion, a key marker of autophagy activation, demonstrates that ARL6IP5 overexpression significantly increases LC3B-II levels . Densitometric analysis confirms this effect is statistically significant compared to control conditions .

  • Dependency on ARL6IP5: Importantly, when ARL6IP5 is knocked down, the autophagy-inducing effects of chemical inducers are significantly attenuated . This suggests that ARL6IP5 may represent a common downstream mediator required for effective autophagy induction regardless of the initial stimulus.

These findings position ARL6IP5 as a potential therapeutic target for enhancing autophagy in disease states, with advantages over chemical inducers in terms of specificity and potentially fewer off-target effects.

How does the ARL6IP5/Rab1/ATG12 axis function in cellular protection?

The ARL6IP5/Rab1/ATG12 axis represents a sophisticated cellular protection mechanism that operates through enhanced autophagy to mitigate protein aggregation and cellular stress. While the complete mechanistic details are still being elucidated, current research has established several key components of this protective pathway:

  • ARL6IP5 as the central regulator: ARL6IP5 serves as a critical hub in this protective axis, directly interacting with and stabilizing ATG12 by preventing its ubiquitination and subsequent degradation . This function increases the availability of ATG12 for incorporation into the autophagy machinery.

  • Rab1 involvement: Though the specific interactions between ARL6IP5 and Rab1 require further investigation, research has identified this small GTPase as an important component of the protective axis . Rab1 is known to regulate vesicle trafficking in the early secretory pathway and has been implicated in autophagosome formation.

  • Coordinated autophagy enhancement: The coordinated actions of ARL6IP5, Rab1, and stabilized ATG12 result in enhanced autophagy flux, which promotes the clearance of protein aggregates such as α-synuclein . This enhanced clearance mechanism provides neuroprotection in models of Parkinson's Disease.

  • Stress response integration: The ARL6IP5/Rab1/ATG12 axis appears to integrate various cellular stress signals to mount an appropriate autophagy response. When this axis is compromised, as occurs with age-related decreases in ARL6IP5 or in pathological conditions, cells become more vulnerable to protein aggregation and associated toxicity .

Understanding the precise molecular interactions and regulatory mechanisms within this axis represents an important frontier in autophagy research and could yield novel therapeutic approaches for neurodegenerative diseases characterized by protein aggregation.

Why might researchers observe variable effects when modulating ARL6IP5 expression?

Researchers may encounter variability in experimental outcomes when modulating ARL6IP5 expression due to several factors that should be systematically addressed:

  • Cell type-specific effects: ARL6IP5 functions may vary substantially between different cell types. While most published research has utilized SH-SY5Y neuroblastoma cells , other cell types may exhibit different baseline expression levels and responses to ARL6IP5 modulation. Researchers should validate findings across multiple relevant cell types when possible.

  • Expression level considerations: The degree of ARL6IP5 overexpression or knockdown efficiency can significantly impact experimental outcomes. Published studies have typically used 5 μg of plasmid DNA for transfection in a standard protocol , but optimization for specific experimental systems is essential. Titration experiments to establish dose-dependent effects are recommended.

  • Timing variables: The temporal dynamics of ARL6IP5 modulation and subsequent assessment of autophagy or neuroprotection can introduce variability. For example, studies have examined ARL6IP5 overexpression effects after 36 hours , but earlier or later timepoints might yield different results due to compensatory mechanisms or protein turnover rates.

  • Interaction with endogenous stress levels: The cellular stress state can influence the effects of ARL6IP5 modulation. Cells under basal conditions versus those experiencing proteotoxic stress (e.g., from α-synuclein overexpression) may respond differently to changes in ARL6IP5 levels . Careful control of experimental conditions and stress levels is therefore essential.

To address these variables, researchers should implement comprehensive experimental designs that include appropriate controls, time-course analyses, dose-response studies, and consistent protocols for assessing autophagy and cellular outcomes.

What are the key considerations for assessing autophagy in ARL6IP5 studies?

Assessing autophagy in ARL6IP5 studies requires careful attention to methodological details to ensure reliable and interpretable results. Key considerations include:

  • Multiple complementary assays: Researchers should employ at least two independent methods to assess autophagy, such as:

    • LC3B-I to LC3B-II conversion via western blotting

    • Fluorescence microscopy to quantify autophagosome formation (puncta)

    • Additional markers such as p62/SQSTM1 levels to assess autophagic flux

  • Autophagy flux assessment: Simply measuring increased LC3B-II levels or autophagosome numbers may not distinguish between enhanced autophagy initiation versus blockade of autophagosome-lysosome fusion. Researchers should incorporate lysosomal inhibitors (e.g., bafilomycin A1) to assess authentic autophagy flux when studying ARL6IP5 effects.

  • Appropriate controls:

    • Empty vector controls for transfection experiments

    • Non-targeting siRNA controls for knockdown studies

    • Positive controls using established autophagy inducers (serum starvation, rapamycin, MβCD) for comparative analysis

  • Quantification approaches:

    • For western blot analysis, densitometric quantification with appropriate normalization to loading controls (e.g., GAPDH)

    • For microscopy, counting of LC3 puncta in at least 25 cells per condition

    • Statistical analysis using appropriate tests (e.g., one-way ANOVA with post hoc Tukey test for multiple comparisons)

By implementing these methodological considerations, researchers can generate more robust and reproducible data regarding ARL6IP5's effects on autophagy pathways.

How can researchers distinguish direct ARL6IP5 effects from indirect consequences?

Distinguishing direct effects of ARL6IP5 from indirect downstream consequences presents a significant challenge in mechanistic studies. To address this challenge, researchers should consider implementing the following experimental approaches:

  • Temporal analysis: Performing time-course experiments after ARL6IP5 modulation can help distinguish primary (rapid) versus secondary (delayed) effects. Early timepoints (e.g., 4-12 hours post-transfection) may reveal direct actions, while later timepoints might reflect adaptive or compensatory responses.

  • Domain mutation studies: Creating and testing ARL6IP5 constructs with mutations in specific functional domains can help identify which regions are required for particular effects. This approach can elucidate structure-function relationships and the molecular basis for ARL6IP5's interactions with partners like ATG12 .

  • Proximity-based interaction assays: Techniques such as proximity ligation assay (PLA), FRET, or BioID can provide evidence for direct physical interactions between ARL6IP5 and putative partners in intact cells. These approaches offer advantages over co-immunoprecipitation by detecting interactions in their native cellular context.

  • Rescue experiments: When studying the consequences of ARL6IP5 knockdown, rescue experiments with wild-type or mutant ARL6IP5 constructs can help establish the specificity of observed effects. Similarly, in overexpression studies, concurrent knockdown of suspected downstream mediators (e.g., ATG12) can determine whether they are required for ARL6IP5's effects .

  • In vitro reconstitution: For biochemical effects such as preventing ATG12 ubiquitination, in vitro reconstitution with purified components can provide strong evidence for direct mechanisms. Such experiments could demonstrate whether ARL6IP5 alone is sufficient to prevent ATG12 ubiquitination or whether additional factors are required.

By systematically implementing these approaches, researchers can build a more detailed and confident understanding of ARL6IP5's direct mechanistic actions versus its broader cellular consequences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.