Recombinant Human Prenylated Rab acceptor protein 1 (RABAC1)

Shipped with Ice Packs
In Stock

Description

Functional Roles

RABAC1 regulates intracellular trafficking through two primary mechanisms:

  • Rab GTPase Recycling: Binds prenylated Rab GTPases (e.g., Rab1A, Rab3A) to prevent their extraction by GDP dissociation inhibitors (GDIs), ensuring proper vesicle docking/fusion .

  • Apoptosis Modulation: Inhibits anti-apoptotic protein BCL2A1, inducing caspase-3 activation and reducing cancer cell survival .

Production and Validation

Recombinant RABAC1 is produced via:

  • Cell-Free Expression Systems: Yields full-length protein (1–185 aa) with >85% purity .

  • CRISPR/Cas9 Knockout Models: HeLa and HEK293 cell lysates (e.g., ab258162, ab265702) validate antibody specificity and functional studies .

Key Validation Data:

AssayResult
Western BlotAnti-PRA1 antibodies (ab76413, 10542-1-AP) detect 21 kDa band
ImmunoprecipitationConfirmed interactions with BCL2A1 and VAMP2
Subcellular LocalizationGolgi, late endosomes, ER-mitochondria contact sites

Interaction Network

RABAC1’s interactome includes trafficking regulators and apoptosis-related proteins:

Interaction PartnerRoleValidation Method
Rab GTPases (Rab1A, Rab3A)Vesicle formation and dockingGST pull-down, co-IP
VAMP2SNARE complex assemblyYeast two-hybrid
BCL2A1Apoptosis inhibitionImmunoprecipitation
PLG (Plasminogen)Extracellular matrix remodelingSTRING database

Research Applications

Recombinant RABAC1 is utilized in:

  • Vesicular Transport Studies: KO cell lines (e.g., HeLa ab265702) dissect Rab recycling pathways .

  • Cancer Research: Overexpression assays link RABAC1 to reduced cell migration/invasion in gastric cancer .

  • Structural Biology: Cell-free expressed protein enables crystallization and motif analysis .

Clinical Relevance

  • Cancer: RABAC1 downregulates BCL2A1, sensitizing cells to cisplatin-induced apoptosis .

  • Neurodegeneration: Altered ER-Golgi trafficking in RABAC1 KO models mimics retinitis pigmentosa phenotypes .

Expression and Localization

  • Tissue Distribution: Ubiquitous, with high expression in brain, pancreas, and cancer cells .

  • Subcellular: Localizes to Golgi (60%), ER-mitochondria contacts (30%), and endosomes (10%) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
RABAC1; PRA1; PRAF1; Prenylated Rab acceptor protein 1; PRA1 family protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RABAC1
Target Protein Sequence
MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRPRNL GELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLESKLV LFGREVSPAHQYALAGGISFPFFWLAGAGSAVFWVLGATLVVIGSHAAFHQIEAVDGEEL QMEPV
Uniprot No.

Target Background

Function
Prenylated Rab acceptor protein 1 (PRA1) is a general Rab protein regulator essential for vesicle formation from the Golgi complex. It potentially controls vesicle docking and fusion by mediating the action of Rab GTPases to the SNARE complexes. Additionally, it inhibits the removal of Rab GTPases from the membrane by GDI.
Gene References Into Functions
  1. Research suggests that NDRG2 and PRA1 might collaborate to prevent signaling of T-cell factor/beta-catenin. PMID: 23068607
  2. PRA1 was identified as an interacting partner of SNCA. PMID: 21798244
  3. These findings highlight novel roles of PRA1 in lipid transport and cell migration. PMID: 20592422
  4. Findings indicate that Yip3 acts catalytically to dissociate complexes of endosomal Rabs bound to GDI and delivers them onto membranes. This suggests that the conserved Yip proteins function as GDI-displacement factors for the targeting of Rab GTPases in eukaryotic cells. PMID: 14574414
  5. Coexpression of a PRA1 export mutant or knockdown of PRA1 resulted in the redistribution of LMP1 and its associated signaling molecules to the endoplasmic reticulum, subsequently impairing LMP1-induced NF-kappaB activation. PMID: 16917502
  6. In vivo modulation of PRA1 may be involved in TCF/beta-catenin signaling, as well as cellular proliferation and tumorigenesis. PMID: 16930546

Show More

Hide All

Database Links

HGNC: 9794

OMIM: 604925

KEGG: hsa:10567

STRING: 9606.ENSP00000222008

UniGene: Hs.11417

Protein Families
PRA1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm. Golgi apparatus. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle.
Tissue Specificity
Ubiquitous. Strongest expression found in placenta, pituitary gland, kidney, lung and stomach.

Q&A

What is RABAC1 and what is its primary cellular function?

RABAC1 (Rab acceptor 1, also known as PRA1, PRAF1, or YIP3) is a 21 kDa transmembrane protein that functions as a GDI (GDP dissociation inhibitor) dissociation factor. It facilitates the transfer of cytosolic GDP-bound Rab GTPases to cellular membranes during vesicular trafficking processes . RABAC1 primarily localizes to the Golgi complex and plays a crucial role in regulating the Rab GTPase cycle, which is essential for proper intracellular vesicle transport. The protein accomplishes this by stabilizing RAB proteins at cell membranes, thus activating them and promoting trafficking functions . Functionally, RABAC1 specifically inhibits the extraction of membrane-bound Rab GTPases by GDI1, effectively maintaining Rabs in their membrane-associated, active state .

How is RABAC1 involved in cellular trafficking pathways?

RABAC1 serves as a key regulator in vesicular trafficking by facilitating the membrane attachment of Rab GTPases. Research indicates that RABAC1 (as Yip3) catalyzes the dissociation of endosomal Rab-GDI complexes, allowing the Rab proteins to associate with their target membranes . In developmental studies using mouse retinas, RABAC1 has been shown to associate with Golgi and perinuclear regions of inner retinal cells, with punctate labeling throughout both plexiform layers. This localization pattern suggests involvement in both Golgi-associated trafficking and post-Golgi transport events . RABAC1's role in trafficking is further demonstrated by studies showing that disruption of its function affects the intracellular distribution of various cargo proteins, potentially redirecting some proteins to degradative pathways like the vacuole .

What experimental approaches are used to study RABAC1 expression patterns?

Several complementary approaches can be employed to study RABAC1 expression:

Immunohistochemistry/Immunofluorescence: For tissue-specific expression, immunohistochemistry using validated RABAC1 antibodies can reveal cellular and subcellular localization patterns. The recommended antibody dilution for immunohistochemistry is 1:20-1:200, while immunofluorescence typically requires 1:10-1:100 dilution . Confocal microscopy with double-labeling techniques using organelle markers (such as GM130 for cis-Golgi) can reveal precise subcellular distribution, as demonstrated in retinal tissue studies .

Western Blotting: For quantitative analysis of RABAC1 protein levels, Western blotting using specific antibodies (recommended dilution 1:500-1:1000) can detect the 21 kDa RABAC1 protein in various tissues and cell lines . This approach is particularly useful for comparing expression levels across different experimental conditions.

RT-PCR and qPCR: For mRNA expression analysis, researchers can employ reverse transcription followed by PCR or quantitative PCR using specific primers. For example, primers 5′-AATGTGAAAGCCAAGATCCAAG-3′ and 5′-CGGAGGCGGAGCACGAGATGAA-3′ have been successfully used to amplify PRA1 in some plant species .

What are the optimal conditions for RABAC1 antibody storage and handling?

To maintain RABAC1 antibody integrity and activity, follow these evidence-based guidelines:

Storage Conditions:

  • Store at -20°C in aliquots to avoid repeated freeze-thaw cycles

  • The antibody remains stable for one year after shipment when properly stored

  • For the specific 10542-1-AP antibody, aliquoting is not necessary for -20°C storage

Buffer Composition:

  • The optimal storage buffer consists of PBS with 0.02% sodium azide and 50% glycerol at pH 7.3

  • Small volume preparations (20μl) often contain 0.1% BSA as a stabilizer

Working Dilutions:

ApplicationRecommended DilutionNotes
Western Blot1:500-1:1000Optimization may be required for each sample type
Immunohistochemistry1:20-1:200For IHC, antigen retrieval with TE buffer pH 9.0 is suggested
Immunofluorescence1:10-1:100Sample-dependent; validation is essential

These recommendations are based on empirical evidence, but researchers should consider titrating the antibody in each testing system to obtain optimal results .

How can researchers effectively design experiments to study RABAC1-mediated trafficking?

Designing robust experiments to investigate RABAC1 trafficking functions requires multiple approaches:

Protein-Protein Interaction Studies:

  • Split ubiquitin yeast two-hybrid (Y2H) assays have successfully identified RABAC1 interactions with trafficking components, as demonstrated in the identification of tomato SlPRA1A and its interaction with LeEIX2

  • Co-immunoprecipitation can verify interactions identified through Y2H in a more physiological context

  • Proximity ligation assays can detect in situ protein-protein interactions in fixed cells

Live Cell Imaging:

  • Fluorescently tagged RABAC1 constructs can be used to track its localization and dynamics

  • Dual-color imaging with established organelle markers helps determine precise subcellular localization

  • FRAP (Fluorescence Recovery After Photobleaching) analysis can reveal the mobility and kinetics of RABAC1 at different cellular compartments

Functional Perturbation Approaches:

  • Overexpression studies using transient transfection can reveal how increased RABAC1 levels affect target protein trafficking. For example, SlPRA1A overexpression decreased LeEIX2 endosomal localization and protein levels

  • RNA interference or CRISPR-based knockdown/knockout approaches can reveal the consequences of RABAC1 depletion

  • Use of specific trafficking inhibitors (e.g., vacuolar degradation inhibitors) can help dissect the pathway in which RABAC1 functions

What methods are available for analyzing RABAC1 effects on protein trafficking?

Researchers can employ several complementary methods to assess how RABAC1 influences protein trafficking:

Quantitative Colocalization Analysis:

  • Measure the degree of colocalization between RABAC1 and proteins of interest using confocal microscopy and established colocalization coefficients (Pearson's, Mander's)

  • Track changes in colocalization following perturbations of RABAC1 levels or function

Protein Degradation Assays:

  • Cycloheximide chase experiments can reveal how RABAC1 affects the turnover rate of target proteins

  • Blocking specific degradation pathways (e.g., using vacuolar inhibitors) can help determine if RABAC1 redirects proteins to degradative compartments, as observed with SlPRA1A and LeEIX2

Trafficking Kinetics:

  • Pulse-chase experiments with fluorescently labeled proteins can track the rate of movement through different compartments

  • Time-lapse microscopy with photoactivatable or photoconvertible fusion proteins can provide spatial and temporal resolution of trafficking events

Biochemical Fractionation:

  • Subcellular fractionation followed by Western blotting can quantitatively assess the redistribution of proteins across different compartments when RABAC1 levels are altered

How does RABAC1 function differ in normal versus pathological conditions?

Studies suggest that RABAC1 expression and function may be altered in various pathological states:

Developmental Context:
Research in mouse models has revealed differential localization patterns of RABAC1 in normal versus degenerative retinas. In wild-type retinas, RABAC1 immunoreactivity is associated with Golgi and perinuclear regions of most inner retinal cells, with punctate labeling throughout both plexiform layers. At P21, intense RABAC1 immunoreactivity is observed in photoreceptor inner segments where Golgi membranes reside, and in outer segments with no staining in the outer nuclear layer .

In contrast, in the rd1 mouse model of retinal degeneration, while a similar pattern of RABAC1 immunoreactivity is observed in the inner retina, the distribution in the developing photoreceptors shows notable differences. These alterations in RABAC1 localization may contribute to the vesicular trafficking defects observed in degenerating photoreceptors during early postnatal development (P4-P8) .

Pathological Implications:
Disruption of Golgi morphology and trafficking has been observed in cells expressing mutant prenylated Rab acceptor-1, suggesting that RABAC1 dysfunction may contribute to diseases characterized by abnormal protein trafficking . The fact that RABAC1 is the only identified gene (other than the mutant PDE6b) to be downregulated at all examined time points in rd1 versus wild-type retinas suggests a potential role in the pathogenesis of retinal degeneration .

How can researchers investigate RABAC1 function in different cellular contexts?

Investigating RABAC1 across different cellular contexts requires targeted approaches:

Cell-Type Specific Analysis:

  • Single-cell RNA sequencing can reveal cell-type specific expression patterns of RABAC1

  • Conditional knockout models using tissue-specific Cre recombinase systems can determine the role of RABAC1 in specific tissues or cell types

  • Cell-type specific promoters can drive expression of tagged RABAC1 for lineage-restricted studies

Developmental Time Course Studies:

  • Temporal analysis of RABAC1 expression during development can reveal stage-specific functions

  • In retinal development studies, sampling at specific postnatal days (P2-P21) revealed dynamic changes in RABAC1 localization patterns

Comparative Analysis Across Species:

  • Phylogenetic analysis of RABAC1 homologs across species can provide evolutionary insights

  • Studies comparing RABAC1 function across model organisms (from yeast to mammals) can reveal conserved mechanisms

  • Alignment of PRA1 protein sequences from diverse species (including Arabidopsis thaliana, Solanum lycopersicum, Oryza sativa, Mus musculus, Homo sapiens, and Saccharomyces cerevisiae) has been used to establish evolutionary relationships

What are the recommended approaches for generating recombinant RABAC1 for functional studies?

Researchers can produce recombinant RABAC1 using several expression systems, each with specific advantages:

Bacterial Expression Systems:

  • E. coli-based expression using pET vectors with His or GST tags facilitates purification

  • For optimal solubility, consider expressing only the soluble domains of RABAC1, as the transmembrane regions may cause aggregation

  • Codon optimization for E. coli expression may improve yields for human RABAC1

Mammalian Expression Systems:

  • For studies requiring post-translational modifications, HEK293 cells have been successfully used to express RABAC1

  • Lentiviral or adenoviral transduction systems enable stable expression in difficult-to-transfect cell types

  • Inducible expression systems (Tet-On/Off) allow controlled expression to prevent potential toxicity

Purification Considerations:

  • Two-step purification protocols (e.g., affinity chromatography followed by size exclusion) can achieve high purity

  • For membrane-associated RABAC1, detergent screening is crucial to maintain protein solubility and function

  • Native purification conditions should be optimized to preserve protein-protein interaction capabilities

How can CRISPR-Cas9 technology be applied to study RABAC1 function?

CRISPR-Cas9 technology offers versatile approaches for investigating RABAC1:

Gene Knockout Studies:

  • Complete RABAC1 knockout can reveal its necessity in fundamental cellular processes

  • Design multiple sgRNAs targeting different exons to ensure complete loss of function

  • Validate knockout efficiency through Western blotting, using antibodies with the recommended dilution of 1:500-1:1000

Knock-in Approaches:

  • Endogenous tagging of RABAC1 with fluorescent proteins or epitope tags enables visualization of native expression levels

  • Introduction of specific mutations can test the functional significance of key residues

  • Creation of conditional alleles allows temporal control of RABAC1 disruption

CRISPRi/CRISPRa Applications:

  • CRISPR interference (CRISPRi) can achieve tunable repression of RABAC1 expression without genetic modification

  • CRISPR activation (CRISPRa) systems can upregulate endogenous RABAC1 to study the effects of increased expression

  • Multiplexed CRISPR approaches can simultaneously modulate RABAC1 and interacting partners to study pathway dependencies

What strategies can be employed to identify novel RABAC1 interaction partners?

Identifying RABAC1 interactors requires both unbiased screening and targeted validation approaches:

Proteomic Approaches:

  • Proximity-based biotinylation (BioID or TurboID) with RABAC1 as the bait protein can identify neighboring proteins in living cells

  • Immunoprecipitation followed by mass spectrometry can identify stable interactors

  • Crosslinking mass spectrometry can capture transient or weak interactions

Yeast Two-Hybrid Screening:

  • Split ubiquitin Y2H systems are particularly suitable for membrane proteins like RABAC1

  • This approach has successfully identified interactions in related proteins, such as the interaction between tomato SlPRA1A and LeEIX2

  • Library screening with RABAC1 as bait can reveal novel interactors across the proteome

Validation Methods:

  • Co-immunoprecipitation in relevant cell types using antibodies specific to RABAC1

  • Bimolecular fluorescence complementation (BiFC) to visualize interactions in living cells

  • Förster resonance energy transfer (FRET) analysis to detect direct protein-protein interactions

How does RABAC1 function differ between mammalian and non-mammalian systems?

RABAC1 exhibits both conserved and divergent functions across species:

Phylogenetic Relationships:
Phylogenetic analysis of PRA1 proteins from diverse species, including Arabidopsis thaliana, Solanum lycopersicum, Oryza sativa, Mus musculus, Homo sapiens, and Saccharomyces cerevisiae, reveals evolutionary relationships that can inform functional studies . The conservation of core functions across diverse species suggests fundamental roles in membrane trafficking.

Functional Conservation:
The basic function of RABAC1 as a regulator of Rab GTPases appears conserved from yeast to humans. In both mammalian and plant systems, PRA1 proteins stabilize RAB proteins at cell membranes, thus activating RABs and promoting trafficking .

System-Specific Adaptations:
In plant systems, SlPRA1A affects receptor-like proteins (RLPs) but not receptor-like kinase (RLK) protein levels, suggesting a specific role in RLP-PRR trafficking and degradation that may differ from mammalian systems . This functional specificity highlights the importance of considering model-specific adaptations when translating findings across species.

What specialized techniques are required for studying RABAC1 in different model organisms?

Research approaches must be tailored to the specific model organism being used:

Mammalian Systems:

  • Human and mouse cell lines (particularly HEK-293) have been successfully used for RABAC1 expression and localization studies

  • Transgenic mouse models with conditional RABAC1 manipulation can reveal in vivo functions

  • Primary neuronal cultures may be particularly relevant given RABAC1's expression in retinal tissues

Plant Systems:

  • Transient expression systems using Agrobacterium-mediated transformation are effective for studying plant RABAC1 homologs

  • Virus-induced gene silencing (VIGS) provides a rapid alternative to stable transformation for loss-of-function studies

  • Specialized imaging techniques for plant cell walls and vacuoles may be required given the unique cellular architecture

Yeast Models:

  • Yeast models offer simplified trafficking pathways that can help delineate core RABAC1 functions

  • Genetic tractability allows for systematic analysis of interactions with the Rab GTPase network

  • The yeast homolog Yip3 has been used to study the catalytic activity in dissociating endosomal Rab-GDI complexes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.