Recombinant Human Presenilins-associated rhomboid-like protein, mitochondrial (PARL)

Shipped with Ice Packs
In Stock

Description

Expression Systems and Purification Protocols

Recombinant PARL is produced using prokaryotic and eukaryotic systems:

ParameterE. coli Pichia pastoris
Yield0.1–1.0 mg/mL1 mg/L culture
TagMyc tag (C-terminal)GFP fusion (for monitoring)
SolubilityRequires detergents (DDM)Membrane-embedded in liposomes
Activity ValidationSDS-PAGE, FRET assays Fluorescence-based assays

E. coli-derived PARL is lyophilized for stability, while Pichia-expressed PARL retains native-like lipid interactions .

Kinetic Properties:

  • Enhanced by Lipids: Activity increases 2–3 fold in IMM-mimetic lipids (e.g., cardiolipin) .

  • Optimal pH: 7.5–8.0, with a k<sub>cat</sub>/K<sub>M</sub> of 1.2 × 10<sup>4</sup> M<sup>−1</sup>s<sup>−1</sup> for PINK1-derived substrates .

  • Substrate Preference: Favors bulky residues (e.g., Phe) at the P1 position, distinct from bacterial rhomboids .

Inhibitor Studies:

  • Ketoamide Inhibitors (e.g., compound 5): Exhibit IC<sub>50</sub> values of 0.15 μM in cells, blocking PGAM5 cleavage and activating PINK1/Parkin mitophagy .

  • Substrate Mimetics: AcRRRAVFLA-4mc (compound 4) is cleaved with k<sub>cat</sub> = 0.15 min<sup>−1</sup> in liposomes .

Mitochondrial Regulation:

  • PINK1 Processing: PARL cleaves PINK1 under steady-state conditions, suppressing Parkin-mediated mitophagy. Inhibition stabilizes PINK1, triggering mitophagy .

  • STARD7 Processing: PARL cleaves STARD7 to enable its cytosolic localization for lipid transfer; knockout cells retain STARD7 in mitochondria .

  • OPA1 Regulation: PARL generates anti-apoptotic OPA1 isoforms, preventing cytochrome c release .

Phosphorylation Effects:

  • Phosphorylation at Ser-65, Thr-69, and Ser-70 inhibits β-cleavage, altering mitochondrial morphology .

Disease Associations:

  • Parkinson’s Disease: PARL dysfunction disrupts PINK1 processing, implicated in autosomal recessive PD .

  • Type 2 Diabetes: PARL polymorphisms correlate with insulin resistance .

Therapeutic Strategies:

  • PARL Inhibitors: Compound 5 activates mitophagy without mitochondrial depolarization, offering a targeted approach for PD .

  • Gene Therapy: Restoring PARL activity in PARL<sup>−/−</sup> models rescues mitochondrial defects .

Comparative Analysis of PARL Constructs

ConstructCatalytic ActivitySubstrate RangeLipid Dependence
Full-Length PARLLowNarrowHigh
β-Cleaved PARL (53–379)HighBroadModerate
S277A MutantInactiveNoneN/A

Challenges and Future Directions

  • Structural Studies: No high-resolution structure exists due to expression hurdles .

  • In Vivo Delivery: Improving inhibitor bioavailability (e.g., compound 5) remains critical .

  • Disease Models: PARL<sup>−/−</sup> mice exhibit metabolic defects, necessitating tissue-specific models .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based solution containing 5%-50% glycerol. For lyophilized powder delivery forms, the buffer used prior to lyophilization is a Tris/PBS-based solution containing 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. For working aliquots, storage at 4°C is suitable for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for customers.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal Myc-tagged
Synonyms
(Mitochondrial intramembrane cleaving protease PARL)
Datasheet & Coa
Please contact us to get it.
Expression Region
53-379aa
Mol. Weight
37.8 kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cancer
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
PARL
Target Protein Sequence
FRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVTGIIAANVLVFCLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKKGGGSK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
PARL, the Presenilins-associated rhomboid-like protein, mitochondrial, is essential for regulating apoptosis during postnatal growth. It plays a critical role in the proteolytic processing of an antiapoptotic form of OPA1, preventing the release of mitochondrial cytochrome c in response to intrinsic apoptotic signals. This function ensures the maintenance of mitochondrial integrity. PARL is also crucial for the maturation of PINK1 into its active 52kDa form. This maturation process involves cleavage by mitochondrial-processing peptidase (MPP) and is essential for the PINK1-mediated mitophagy pathway, which eliminates damaged mitochondria. Furthermore, PARL promotes changes in mitochondrial morphology through the phosphorylation of its P-beta domain, impacting mitochondrial dynamics and function.
Gene References Into Functions
  1. PARL maintains mitochondrial membrane homeostasis through the processing of STARD7, emerging as a critical regulator of protein localization between mitochondria and the cytosol. PMID: 29301859
  2. Research has confirmed the association of common variants in PARL and PINK1 with leprosy. Notably, PARL and PINK1 interact physically and are involved in a complex network of genes associated with leprosy susceptibility. PMID: 27876828
  3. PDK2/PARL functions as a sensor for defects in mitochondrial bioenergetics. PMID: 28178523
  4. The adipogenic process can be divided into three stages based on the involvement of the PARL-PINK1-Parkin system. Findings highlight the sequential adipogenic events orchestrated by this system, providing further evidence for the convergence of pathogenesis leading to neurodegenerative and metabolic diseases. PMID: 28641777
  5. These findings expand the allelic spectrum of ABCC5 in primary open-angle glaucoma (PACG). Notably, no tagging SNP responsible for the association of the entire region was identified. PMID: 28813580
  6. Research reveals a pro-apoptotic function of PARL. Specifically, PARL-mediated processing of Smac and cytochrome c release, facilitated by OPA1-dependent cristae remodelling, are identified as two independent pro-apoptotic pathways within mitochondria. PMID: 28288130
  7. Mutations in PARL are a rare cause of Parkinson's disease (PD), and genetic variants are not considered strong or common risk factors for the disease. PMID: 26778534
  8. Pathogenic PINK1 mutants, which are not cleaved by PARL, affect PINK1 kinase activity and the ability to induce PARK2-mediated mitophagy. PMID: 26101826
  9. Common genetic variants of the PINK1 and PARL genes are unlikely to be involved in schizophrenia. PMID: 25354644
  10. The frequency of the haplotypes AAC and AAT was significantly higher in unaffected cases, while the frequency of the GGT haplotype was significantly higher in Leber's hereditary optic neuropathy (LHON) cases. PMID: 23973714
  11. The rhomboid protease PARL mediates the mitochondrial membrane potential loss-induced cleavage of PGAM5. PMID: 22915595
  12. The p.S77N variant, and possibly mutations in the PARL protein overall, are not a frequent cause of autosomal recessive early-onset Parkinson's disease. PMID: 21953724
  13. Research provides insights into the structural determinants regulating Parl stability and activity in vivo, revealing a complex cascade of proteolytic events controlling the function of the protease in the mitochondrion. PMID: 21415861
  14. PARL deficiency impairs PARKIN recruitment to mitochondria. PMID: 21355049
  15. The PARL-catalyzed removal of the Pink1 signal sequence in the canonical import pathway acts as a cellular checkpoint for mitochondrial integrity. PMID: 21426348
  16. The mitochondrial protease PARL cleaves PINK1 at position A103. PMID: 21138942
  17. Data indicates no association between PARL gene SNPs and LHON in Chinese patients with the m.11778G>A mutation. PMID: 20711738
  18. Variants of PARL are suggested to influence cell death by apoptosis, a process long believed to be implicated in the neurodegeneration of LHON. PMID: 20407791
  19. Results suggest that genetic variation within PARL influences mitochondrial abundance and integrity. PMID: 19862556
  20. Findings indicate a distinct function and mechanism of Hax1 in apoptosis, re-opening the question of whether mammalian PARL, in addition to apoptosis, regulates mitochondrial stress response through Omi/HtrA2 processing. PMID: 19680265
  21. PARL might mediate a developmentally regulated mitochondria-to-nuclei signaling through regulated proteolysis of its N terminus and release of the Pbeta peptide. PMID: 14732705
  22. Variation in PARL sequence and/or expression may be a significant new risk factor for type 2 diabetes and other components of the metabolic syndrome. PMID: 15729572
  23. The Leu262Val variant is unlikely to be a major contributor to insulin resistance. PMID: 17019603
  24. The PARL rs3732581 genetic variant may play a role in insulin levels, metabolic syndrome, and coronary artery disease. PMID: 18758826
  25. Genetic variation in PARL may indicate an earlier onset of type 2 diabetes and an increased susceptibility to nephropathy and cardiovascular complications. PMID: 19185381

Show More

Hide All

Database Links

HGNC: 18253

OMIM: 607858

KEGG: hsa:55486

STRING: 9606.ENSP00000325421

UniGene: Hs.478469

Protein Families
Peptidase S54 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.; [P-beta]: Nucleus.

Q&A

What is the optimal expression system for producing recombinant human PARL?

Expression SystemAdvantagesDisadvantagesOptimal Applications
E. coliHigh yield, low cost, rapidLimited PTMs, inclusion body formationFunctional domains, binding studies
Mammalian cellsNative PTMs, proper foldingLower yield, higher costInteraction studies, activity assays
Insect cellsHigher yield than mammalian, most PTMsModerate cost, glycosylation differencesStructural studies, large-scale purification
Cell-free systemsRapid, accommodates toxic proteinsExpensive, limited PTMsInitial screening, directed evolution

For optimal results, include a cleavable tag (His6 or GST) at the N-terminus, and consider a TEV protease site for tag removal during purification .

How can I verify the functional activity of recombinant PARL in vitro?

Functional verification of recombinant PARL requires multiple complementary approaches. The primary method involves protease activity assays using fluorogenic peptide substrates derived from known PARL targets. These assays should include positive controls (commercially available rhomboid proteases) and negative controls (catalytically inactive PARL mutants with the conserved serine residue in the catalytic dyad mutated to alanine) .

Additional verification methods include:

  • Western blot analysis to confirm PARL-mediated cleavage of known substrates (PINK1, PGAM5)

  • Co-immunoprecipitation assays to verify protein-protein interactions

  • Circular dichroism to confirm proper protein folding

  • Size-exclusion chromatography to assess oligomeric state

Each verification method should be performed under various pH and temperature conditions to establish optimal parameters for enzymatic activity. For quantitative analysis, develop a standard curve using known concentrations of cleaved substrate to enable precise determination of enzymatic rates .

What are the key considerations for designing PARL knockout experiments?

When designing PARL knockout experiments, researchers should carefully consider several methodological aspects to ensure valid and interpretable results. First, select the appropriate model system based on research questions – cell lines for biochemical studies, or animal models for physiological relevance. For CRISPR-Cas9 approaches, design at least three gRNAs targeting different exons, with particular focus on regions encoding the catalytic domain .

Important experimental design considerations include:

  • Include proper controls: wild-type, heterozygous knockouts, and rescue experiments with re-expressed PARL

  • Validate knockout efficiency at both protein and genomic levels

  • Assess potential compensatory mechanisms (upregulation of other mitochondrial proteases)

  • Monitor cell/organism viability as PARL depletion may affect mitochondrial function

  • Examine phenotypes across different conditions, particularly under mitochondrial stress

When analyzing results, account for potential off-target effects and consider conducting parallel experiments using RNAi-mediated knockdown to confirm phenotypes. These approaches provide complementary evidence while minimizing methodology-specific artifacts .

How can apparent contradictions in PARL's role in mitophagy be experimentally resolved?

The contradictory findings regarding PARL's role in mitophagy can be addressed through carefully designed experimental approaches that account for context-dependency. First, establish standardized conditions for studying mitophagy by using multiple induction methods (CCCP, antimycin A, valinomycin) at defined concentrations and timepoints to distinguish between different mitophagy pathways .

To resolve contradictions, implement a multi-faceted experimental approach:

  • Conduct time-course experiments to capture the dynamic nature of PARL's involvement in mitophagy

  • Compare results across different cell types (neurons, fibroblasts, myocytes) to identify tissue-specific effects

  • Generate domain-specific mutations rather than complete knockouts to distinguish between PARL's multiple functions

  • Employ advanced imaging techniques (super-resolution microscopy, live-cell imaging) to visualize PARL activity in real-time

Additionally, use quantitative proteomics to profile the complete mitochondrial proteome under various conditions in both PARL-present and PARL-deficient systems. This approach can reveal condition-specific interaction partners and substrates. Contradictions often arise from differences in experimental models, timing of observations, and methods of mitophagy induction, so explicitly accounting for these variables is essential for data reconciliation .

What experimental approaches can distinguish between direct and indirect PARL substrates?

Distinguishing between direct and indirect PARL substrates requires a systematic multi-method approach. Begin with in vitro cleavage assays using purified recombinant PARL and candidate substrate proteins under controlled conditions. Direct substrates will show cleavage patterns that are abolished when using catalytically inactive PARL mutants .

For comprehensive substrate identification and validation:

  • Implement proximity labeling techniques (BioID, APEX) with PARL as the bait protein to identify proteins in close physical proximity

  • Perform comparative N-terminomics on control and PARL-deficient cells to identify differential cleavage events

  • Conduct in vitro reconstitution studies with purified components in proteoliposomes to confirm direct substrate processing

  • Use site-directed mutagenesis to alter potential cleavage sites in candidate substrates

The most definitive approach combines biochemical evidence with structural data, such as co-crystallization of PARL with substrate peptides or cryo-EM studies of PARL-substrate complexes. When analyzing results, apply stringent criteria for direct substrates: physical interaction, sequence-specific cleavage, dependence on PARL's catalytic activity, and altered processing in PARL-deficient systems .

How can researchers accurately quantify PARL-dependent effects on mitochondrial dynamics?

Accurately quantifying PARL-dependent effects on mitochondrial dynamics requires multi-parameter analysis combining morphological assessment with functional measurements. Implement high-content imaging platforms with automated analysis algorithms to quantify mitochondrial network parameters, including branch length, connectivity, aspect ratio, and fragmentation index .

For comprehensive assessment:

ParameterMeasurement TechniqueAnalysis MethodControl Comparison
MorphologyConfocal microscopy with mitochondrial markersMiNA, Mitochondrial Network AnalysisWild-type vs. PARL-deficient
Fusion/Fission EventsLive-cell imaging with photoactivatable GFPEvent counting, frequency analysisBasal vs. stressed conditions
Membrane PotentialTMRM, JC-1 fluorescenceFlow cytometry, ratiometric imagingPopulation distribution analysis
Respiratory FunctionSeahorse XF analyzersOCR/ECAR measurementsSubstrate-specific responses
MotilityTime-lapse microscopyParticle tracking algorithmsDirectional persistence analysis

To establish causality, implement acute manipulation of PARL activity using optogenetic or chemical-genetic approaches rather than relying solely on stable knockout/knockdown models. This allows temporal correlation between PARL activity changes and subsequent alterations in mitochondrial dynamics parameters. Additionally, rescue experiments with wild-type or mutant PARL variants can confirm specificity of observed effects .

What controls are essential when measuring PARL processing of PINK1?

When measuring PARL processing of PINK1, several critical controls must be incorporated to ensure experimental validity and interpretable results. First, include both positive controls (cells with known PARL activity) and negative controls (PARL knockout cells, catalytically inactive PARL mutants) .

Essential experimental controls include:

  • Membrane potential manipulations: Compare conditions with intact (DMSO vehicle) and dissipated (CCCP, antimycin A) mitochondrial membrane potential

  • Import controls: Include mitochondrial proteins that are imported but not processed by PARL

  • Specificity controls: Test other mitochondrial proteases (OMA1, YME1L) to distinguish their effects from PARL-specific processing

  • Time-course sampling: Measure PINK1 processing at multiple timepoints to capture the dynamic nature of the process

  • Subcellular fractionation quality controls: Verify the purity of mitochondrial fractions using markers for different compartments

For quantitative analysis, implement multiple detection methods (Western blotting, mass spectrometry, fluorescently-tagged reporters) to cross-validate results. Additionally, carefully calibrate antibody specificity, as commercial antibodies may recognize different forms of PINK1 with varying efficiency. Statistical analysis should include technical replicates (minimum n=3) and biological replicates across different cell preparations or animal cohorts .

How should researchers design experiments to investigate PARL's tissue-specific functions?

Designing experiments to investigate PARL's tissue-specific functions requires a comprehensive approach that accounts for physiological context. Begin by generating tissue-specific conditional knockout models using Cre-loxP systems under the control of tissue-specific promoters, focusing on tissues with high mitochondrial content (brain, heart, skeletal muscle, liver) .

Implement a systematic experimental design framework:

  • Characterize baseline expression patterns using quantitative methods (qPCR, Western blot) across multiple tissues and developmental stages

  • Compare acute vs. chronic PARL depletion using inducible knockout systems to distinguish developmental from homeostatic roles

  • Analyze tissue-specific interaction partners through comparative proteomics of PARL complexes isolated from different tissues

  • Assess tissue-specific phenotypes using appropriate functional assays (electrophysiology for neurons, contractility for muscle)

  • Examine responses to tissue-relevant stressors (excitotoxicity for neurons, ischemia-reperfusion for heart)

For human relevance, complement animal studies with analyses of patient-derived cells from individuals with different tissue-affected pathologies. Additionally, develop organoid models from human stem cells to recreate tissue-specific niches in vitro. Statistical analyses should account for inter-individual variation and employ hierarchical designs when comparing multiple tissues within the same genetic background .

What methodological approaches can overcome the challenges of studying membrane-bound proteases like PARL?

Studying membrane-bound proteases like PARL presents unique challenges that require specialized methodological approaches. The hydrophobic nature of these proteins complicates expression, purification, and functional characterization. To overcome these challenges, implement a multi-faceted strategy .

For expression and purification:

  • Use specialized detergents (DDM, LMNG) or amphipols to maintain protein stability

  • Employ nanodiscs or liposomes to reconstitute PARL in a membrane-like environment

  • Consider fusion with solubility-enhancing partners (MBP, SUMO) that can be cleaved after purification

  • Implement on-column refolding protocols for recovery from inclusion bodies

For functional studies:

  • Develop fluorogenic substrates that can penetrate membranes or be targeted to mitochondria

  • Use split-reporter systems that reconstitute fluorescence upon cleavage

  • Implement in-gel activity assays with native protein complexes

  • Employ hydrogen-deuterium exchange mass spectrometry to analyze conformational dynamics

For structural characterization, combine multiple approaches including cryo-EM of membrane protein complexes, NMR of specific domains, and computational modeling. Additionally, develop cell-based assays with reporter substrates that can be monitored non-invasively to assess PARL activity in living systems over time. These methodological adaptations enable more comprehensive investigation of membrane proteases despite their inherent experimental challenges .

How can researchers differentiate between primary effects of PARL manipulation and secondary mitochondrial stress responses?

Differentiating between primary effects of PARL manipulation and secondary mitochondrial stress responses requires careful experimental design and data interpretation. Implement acute manipulation systems (such as chemical genetics or optogenetics) to achieve temporal control over PARL activity, enabling observation of immediate versus delayed effects .

Key analytical approaches include:

  • Time-course experiments with high temporal resolution to establish the sequence of events

  • Parallel monitoring of multiple mitochondrial parameters (membrane potential, ROS production, calcium handling)

  • Single-cell analyses to capture population heterogeneity and identify cellular subsets with primary responses

  • Pharmacological inhibition of known stress response pathways to determine dependence relationships

  • Mathematical modeling to distinguish direct causality from feedback loops

For data interpretation, apply causal network analysis methods that can infer directionality between observed changes. Additionally, compare phenotypes between PARL manipulation and direct induction of mitochondrial stress (using uncouplers or respiratory chain inhibitors) to identify PARL-specific signatures. Statistical methods should account for the dynamic nature of the data, employing time-series analysis approaches rather than simple endpoint comparisons .

What statistical approaches are most appropriate for analyzing variability in PARL-related phenotypes?

The appropriate statistical approaches for analyzing variability in PARL-related phenotypes must account for the complex, multi-level nature of mitochondrial biology. Begin with exploratory data analysis including visualization techniques (box plots, violin plots) to characterize distribution patterns across experimental conditions .

For robust statistical analysis:

  • Implement mixed-effects models to account for nested data structures (multiple cells within samples, multiple samples within experiments)

  • Consider non-parametric methods when data violate normality assumptions, which is common with mitochondrial parameters

  • Apply multivariate approaches (principal component analysis, clustering) to identify patterns across multiple measured variables

  • Utilize time-series analysis methods for dynamic processes (mitochondrial membrane potential fluctuations, calcium oscillations)

  • Implement Bayesian approaches to integrate prior knowledge with experimental data

Power analyses should be performed a priori, accounting for the typically high biological variability in mitochondrial parameters. For studies comparing multiple genetic backgrounds or treatments, implement correction for multiple comparisons using methods that balance false positive control with statistical power (such as the Benjamini-Hochberg procedure). When reporting results, include complete data distribution information rather than simply means and standard errors .

How should contradictory findings in PARL research literature be reconciled methodologically?

Reconciling contradictory findings in PARL research literature requires systematic methodology that addresses potential sources of discrepancy. Begin by performing a structured comparison of experimental conditions across contradictory studies, focusing on cell types, genetic backgrounds, experimental timeframes, and specific methodologies .

Implement a reconciliation framework with these components:

  • Direct replication studies that systematically vary one parameter at a time to identify critical factors driving divergent results

  • Collaborative multi-laboratory studies using standardized protocols to assess reproducibility

  • Meta-analysis of published data with subgroup analyses based on methodological variations

  • Development of consensus reporting standards for PARL experiments to ensure critical parameters are consistently reported

When designing validation experiments, include positive and negative controls from contradictory studies, and implement multiple complementary techniques to measure the same parameter. Additionally, consider context-dependency - contradictory findings may reflect true biological complexity rather than experimental error. Explicitly test for potential modulating factors such as metabolic state, cell cycle stage, or mitochondrial stress levels that might explain different outcomes under seemingly similar conditions .

What emerging technologies show promise for advancing understanding of PARL function?

Several emerging technologies demonstrate significant promise for advancing our understanding of PARL function. CRISPR-based technologies beyond gene knockout offer unprecedented precision for studying PARL, including base editors for introducing specific mutations and CRISPR activation/interference for modulating expression without genetic modification .

Promising technological approaches include:

  • Proximity labeling methods (TurboID, APEX2) for mapping the dynamic PARL interactome under various conditions

  • Cryo-electron tomography for visualizing PARL in its native mitochondrial membrane environment

  • Single-molecule tracking to observe PARL dynamics and substrate interactions in living cells

  • CRISPR screens with mitochondrial readouts to identify genetic modifiers of PARL function

  • Patient-derived mitochondrial organoids to study PARL in disease-relevant contexts

Mass spectrometry-based approaches, particularly mitochondrial spatial proteomics and targeted metabolomics, can provide comprehensive views of how PARL influences mitochondrial compartmentalization and metabolism. Additionally, the development of mitochondria-targeted biosensors allows real-time monitoring of parameters like pH, calcium, or protease activity in specific mitochondrial subcompartments. These technologies, when integrated through computational approaches, promise to reveal PARL's multifaceted roles in mitochondrial biology .

How can translational researchers bridge findings from basic PARL studies to clinical applications?

Bridging basic PARL research to clinical applications requires systematic translational approaches that connect molecular mechanisms to disease pathophysiology. Begin by establishing the relevance of PARL to human disease through genetic association studies, analysis of PARL expression/activity in patient samples, and correlation of PARL-dependent pathways with clinical outcomes .

Effective translational research strategies include:

  • Development of cell-based assays for PARL activity that can be applied to patient-derived samples

  • Establishment of biomarker panels based on PARL substrates or downstream effectors

  • Creation of patient stratification methods based on PARL pathway activity

  • Design of high-throughput screens for compounds that modulate PARL function

  • Generation of humanized animal models that recapitulate patient-specific PARL variants

When developing therapeutic approaches, consider the context-dependent roles of PARL, as both enhancement and inhibition may be beneficial depending on the disease context. Implementation of adaptive clinical trial designs that incorporate biomarkers of PARL pathway activity can help identify patient subpopulations most likely to benefit from specific interventions. Additionally, establish interdisciplinary collaborations between basic scientists and clinicians to ensure research questions address clinically relevant aspects of PARL biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.