Recombinant Human Probable E3 ubiquitin-protein ligase RNF217 (RNF217)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Probable E3 Ubiquitin-Protein Ligase RNF217 (RNF217)

Recombinant Human Probable E3 Ubiquitin-Protein Ligase RNF217, encoded by the RNF217 gene, is a protein-coding gene in humans . The RNF217 protein contains two RING finger domains linked by an in-between-RING fingers (IBR) motif . RNF217 is highly conserved across species . It functions as a novel E3 ubiquitin ligase, mediating the degradation of the iron exporter ferroportin (FPN) and regulating iron homeostasis . RNF217 has also been implicated in the development of leukemia .

Gene and Protein Structure

The RNF217 gene is located on chromosome 6q . RNF217 encodes a 284 amino acid protein with a calculated molecular mass of 30 kDa . The protein contains three domains: a variant N-terminal RING finger (RING1), an IBR (in-between-RING fingers) domain, also known as a double RING finger linked motif (DRIL), and a consensus RING finger (RING2) at the C-terminal end .

The RING1 domain in RNF217 has a lysine residue rather than a histidine residue at the H4 position, and the spacing between cysteines 7 and 8 in RING1 is four amino acids compared to two amino acids in the consensus sequence . RNF217 is highly conserved across species, with 98.6% amino acid identity between human and mouse RNF217 and 76.8% between human and Fugu rubripes .

Function in Iron Homeostasis

RNF217 functions as an E3 ubiquitin ligase that mediates the degradation of ferroportin (FPN), the only known cellular iron exporter, thereby regulating iron homeostasis .

Key points regarding RNF217's role in iron homeostasis :

  • RNF217 promotes the degradation of FPN.

  • RNF217 expression is upregulated by Tet1-mediated demethylation; loss of Tet1 stabilizes FPN and impairs the response to iron overload.

  • Knocking out RNF217 in macrophages increases splenic iron export by stabilizing FPN, whereas knocking out RNF217 in intestinal cells appears to increase iron absorption.

  • The Tet1-RNF217-FPN axis regulates iron homeostasis.

Role in Leukemia

High expression of RNF217 in certain human leukemias suggests that the deregulation of this gene could be a common mechanism in leukemia development . RNF217 interacts with the anti-apoptotic protein HAX1, and this interaction can be mapped to the C-terminal RING finger motif of RNF217 .

Expression analysis in leukemia patient samples has shown that myeloid leukemia samples have higher RNF217 expression compared to lymphoblastic leukemia samples . Specifically, chronic myeloid leukemia (CML) and acute myeloid leukemia (AML) samples with a normal karyotype have the highest levels of RNF217 expression .

RNF213 and RNF217 Comparison

RNF213 and RNF217 are both RING finger proteins, but they have distinct functions and characteristics. RNF213 is a large E3 ubiquitin ligase associated with moyamoya disease and has a molecular weight of 591 kDa . RNF217, on the other hand, has a molecular weight of 30kDa and is involved in iron homeostasis and leukemia development . RNF213 contains both AAA+ ATPase and ubiquitin ligase activities, and it can form various types of ubiquitin chains, including M1, K11, K48, and K63, depending on the specific pathogens involved .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RNF217; C6orf172; IBRDC1; OSTL; E3 ubiquitin-protein ligase RNF217; IBR domain-containing protein 1; Opposite STL; RING finger protein 217
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RNF217
Target Protein Sequence
MKVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHF TTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHEGVNCKEYKKGDKLLRHWASE IEHGQRNAQKCPKCKIHIQRTEGCDHMTCSQCNTNFCYRCGERYRQLRFFGDHTSNLSIF GCKYRYLPERPHLRRLVRGSVCAGKLFIAPLIMVLGLALGAIAVVIVEEIKTYWNLISGR TRNQTQHLAPQPVLLSDMLYCLKQVFICISYLLPL
Uniprot No.

Target Background

Function
RNF217 is an E3 ubiquitin-protein ligase that accepts ubiquitin from E2 ubiquitin-conjugating enzymes via a thioester bond, subsequently transferring it to target substrates. It mediates the degradation of ferroportin/SLC40A1, an iron exporter, thereby regulating iron homeostasis.
Gene References Into Functions
  1. The elevated expression of RNF217 in certain human leukemias suggests that its dysregulation may be a common mechanism in leukemogenesis. PMID: 25298122
Database Links

HGNC: 21487

KEGG: hsa:154214

STRING: 9606.ENSP00000352734

UniGene: Hs.12876

Protein Families
RBR family, RNF217 subfamily
Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm.
Tissue Specificity
Mainly expressed in testis and skeletal muscle.

Q&A

What is the primary function of RNF217 in cellular physiology?

RNF217 functions primarily as an E3 ubiquitin ligase that mediates the degradation of ferroportin (FPN), the body's sole iron exporter. By targeting FPN for ubiquitination and subsequent degradation, RNF217 plays a central role in regulating intracellular and systemic iron homeostasis . The mechanism involves RNF217-mediated poly-ubiquitination of FPN, which marks it for degradation through the proteasomal pathway. This process is particularly important in contexts where iron levels need to be tightly regulated, such as in macrophages involved in iron recycling and in duodenal enterocytes responsible for dietary iron absorption .

How is RNF217 expression regulated at the epigenetic level?

RNF217 expression is regulated through an epigenetic mechanism involving the ten-eleven translocation methylcytosine dioxygenase 1 (TET1). Specifically, TET1 mediates demethylation of the RNF217 promoter region, which upregulates RNF217 expression . Under conditions of increased iron, this epigenetic regulation becomes particularly relevant. Research has demonstrated that loss of Tet1 expression leads to decreased RNF217 levels, resulting in FPN accumulation and impaired responses to iron overload. This manifests as abnormal iron distribution, with increased accumulation in the liver and decreased levels in the spleen and duodenum .

What is the relationship between RNF217 and its antisense transcript RNF217-AS1?

RNF217-AS1 is an antisense transcript of RNF217 that was initially classified as a long non-coding RNA (lncRNA). Recent investigations have revealed that despite its classification as a lncRNA, RNF217-AS1 possesses peptide-coding potential . Through ribosome sequencing (Ribo-seq) and mass spectrometry validation, researchers have confirmed that RNF217-AS1 encodes a functional short peptide. This peptide has been demonstrated to exhibit biological activities distinct from RNF217 itself, including inhibition of tumorigenesis and reduction of macrophage recruitment in Schwann cells . This finding illustrates the complex genomic organization at the RNF217 locus, where bidirectional transcription produces molecules with potentially opposing biological functions.

What tissue distribution pattern does RNF217 exhibit?

RNF217 (formerly annotated as OSTL) exhibits a tissue-specific expression pattern, with highest expression levels detected in testis and skeletal muscle . Additionally, RNF217 demonstrates regulated splicing patterns during B cell development, resulting in multiple splice variants . The protein is also expressed in various hematological contexts, including human B cell leukemia cell lines, primary human chronic myeloid leukemia samples, acute myeloid leukemia with normal karyotype, and acute T-cell acute lymphoblastic leukemia (T-ALL) samples . This varied expression pattern suggests that RNF217 may play roles beyond iron metabolism, potentially including functions in immune cell development and hematological malignancies.

How does the interaction between RNF217 and HAX1 influence cellular apoptosis pathways?

RNF217 has been identified as an interaction partner of HCLS1-associated protein X-1 (HAX1), an anti-apoptotic protein, through yeast two-hybrid screening . This interaction occurs specifically via the C-terminal RING finger motif of RNF217. HAX1 is known to promote cell survival by inhibiting apoptosis through various mechanisms, including mitochondrial membrane stabilization. The functional significance of this RNF217-HAX1 interaction suggests a potential role for RNF217 in modulating apoptotic pathways, beyond its established function in iron homeostasis .

Research indicates that deregulated expression of RNF217, potentially resulting from chromosomal aberrations involving 6q, might disrupt balanced apoptosis signaling through altered interaction with HAX1. This imbalance could contribute to leukemia development by promoting cell survival and resistance to apoptotic stimuli . Future studies should focus on elucidating the precise molecular mechanisms by which RNF217-HAX1 interaction influences apoptotic thresholds in different cellular contexts.

What are the cell type-specific consequences of RNF217 knockout on iron metabolism?

Conditional knockout models have revealed fascinating cell type-specific roles for RNF217 in iron homeostasis. Research using two conditional knockout mouse lines demonstrated that:

  • Macrophage-specific RNF217 knockout: Deletion of RNF217 in macrophages (using Lysm-Cre driver) resulted in increased FPN protein levels, enhancing iron export from splenic macrophages and bone marrow-derived macrophages (BMDMs) .

  • Intestinal-specific RNF217 knockout: Removal of RNF217 in intestinal enterocytes appeared to increase iron absorption through stabilization of FPN .

These findings highlight the context-dependent functions of RNF217 in different cell types involved in systemic iron homeostasis. The differential effects observed in macrophages versus intestinal cells suggest that therapeutic targeting of RNF217 would need to consider cell type-specific outcomes to avoid unintended consequences on iron metabolism.

How does RNF217 function in the context of hepcidin-mediated iron regulation?

Hepcidin is a peptide hormone produced primarily by hepatocytes in response to increased iron or inflammation. It binds to FPN, inducing its internalization and subsequent degradation, thus regulating systemic iron levels. The relationship between hepcidin and RNF217-mediated degradation of FPN represents a complex regulatory network .

Experimental data from RNF217 conditional knockout mice demonstrate differential responses to hepcidin administration and inflammatory stimuli. When RNF217 is absent in macrophages, the cells show altered responses to hepcidin and lipopolysaccharide (LPS) treatment . Specifically, macrophages lacking RNF217 maintain higher FPN levels even after hepcidin administration, suggesting that RNF217 is involved in the degradation pathway downstream of hepcidin-induced FPN internalization .

The precise molecular interplay between hepcidin-induced internalization of FPN and RNF217-mediated ubiquitination requires further investigation to determine whether these represent parallel or sequential pathways in FPN regulation.

What is the potential role of RNF217 in hematological malignancies?

RNF217 (previously annotated as OSTL) was initially identified in the context of chromosomal translocations associated with leukemia . The gene is located on chromosome 6q, a region frequently involved in recurring aberrations in hematological malignancies. RNF217 shows regulated splicing during B cell development and is expressed in various leukemia cell lines and primary samples .

The interaction of RNF217 with the anti-apoptotic protein HAX1 provides a mechanistic link to leukemogenesis. Imbalanced apoptosis signaling due to deregulated RNF217 expression could promote leukemic cell survival . Additionally, given RNF217's role in iron homeostasis, and the critical importance of iron for cell proliferation and metabolism, altered RNF217 function might confer advantages to malignant cells through modulation of iron availability.

Future research should explore whether specific RNF217 variants or expression patterns correlate with prognostic outcomes in leukemia and whether targeting RNF217 could represent a novel therapeutic approach for certain hematological malignancies.

Methodological Approaches

Detection of RNF217-mediated ubiquitination of FPN requires specialized techniques to capture this transient post-translational modification. Based on published methodologies, the following approaches are recommended:

  • Co-immunoprecipitation with ubiquitin detection: Express tagged versions of FPN (e.g., FPN-Myc) and RNF217 (e.g., RNF217-Flag) in HEK293T cells, immunoprecipitate using antibodies against the tag (protein A/G beads conjugated with Myc or Flag antibodies), and then immunoblot with the other antibody to detect interaction .

  • Ubiquitination assay: For detecting ubiquitinated FPN, immunoprecipitate FPN from cell lysates (either endogenous FPN from BMDMs or exogenously expressed FPN-Myc from HEK293T cells) and immunoblot using the FK2 anti-poly-Ub antibody .

  • Proteasome inhibition: To enhance detection of ubiquitinated species, treat cells with proteasome inhibitors (e.g., MG132) prior to lysis to prevent degradation of ubiquitinated proteins.

  • Mutational analysis: Generate RNF217 mutants, particularly focusing on the RING finger domain, to identify critical residues required for ubiquitin ligase activity and FPN interaction .

These approaches should be complemented with appropriate controls, including immunoglobulin G negative controls and input samples as positive controls .

How can researchers effectively measure iron distribution in RNF217 experimental models?

Accurate measurement of iron distribution is essential when studying the effects of RNF217 manipulation on iron homeostasis. Based on methodologies described in the literature, researchers should consider the following approaches:

  • Tissue iron quantification: Measure iron content in relevant tissues (liver, spleen, duodenum) using colorimetric assays (e.g., ferrozine-based methods) or atomic absorption spectroscopy .

  • Histological assessment: Perform Perls' Prussian blue staining on tissue sections to visualize iron deposits and assess their distribution within tissues.

  • Iron-related protein expression: Analyze expression levels of key iron metabolism proteins (FPN, ferritin, transferrin receptor) by western blotting, immunohistochemistry, or immunofluorescence to complement direct iron measurements .

  • Serum iron parameters: Measure serum iron, transferrin saturation, and ferritin levels to assess systemic iron status.

  • Isotope tracing: For dynamic studies of iron flux, consider using isotope-labeled iron (e.g., 59Fe) to track iron movement between tissues following manipulation of RNF217 expression.

When analyzing iron distribution data, it's crucial to consider that changes in one tissue must be interpreted in the context of the entire iron cycle, as alterations in one compartment typically affect iron levels in other tissues .

What approaches can be used to investigate the epigenetic regulation of RNF217 by TET1?

To investigate the epigenetic regulation of RNF217 by TET1, researchers should employ a combination of the following methodologies:

  • DNA methylation analysis: Assess methylation status of the RNF217 promoter using bisulfite sequencing or methylation-specific PCR to identify CpG sites regulated by TET1 .

  • Chromatin immunoprecipitation (ChIP): Perform ChIP assays using antibodies against TET1 to confirm direct binding to the RNF217 promoter region .

  • TET1 manipulation: Use TET1 knockout or knockdown models to examine effects on RNF217 expression and promoter methylation status .

  • Reporter assays: Clone the RNF217 promoter region into a luciferase reporter construct to assess how TET1 expression or methylation status affects promoter activity.

  • Iron response elements: Investigate whether iron status affects TET1 binding to the RNF217 promoter by treating cells with iron chelators or iron supplements prior to ChIP assays.

These approaches should be combined with functional readouts of RNF217 activity (e.g., FPN levels, ubiquitination assays) to establish the biological significance of the epigenetic regulation .

What is the potential of targeting RNF217 for iron-related disorders?

Given RNF217's role in iron homeostasis, therapeutic targeting of this E3 ubiquitin ligase represents a promising approach for disorders characterized by iron dysregulation. Several strategies could be considered:

  • For iron overload disorders (e.g., hereditary hemochromatosis): Enhancing RNF217 activity could promote FPN degradation, limiting iron absorption and export from macrophages, potentially reducing systemic iron burden .

  • For iron deficiency conditions: Inhibiting RNF217 could stabilize FPN, potentially increasing iron absorption from the intestine and iron release from macrophage stores .

  • For disorders with iron maldistribution: Cell type-specific modulation of RNF217 activity could help redistribute iron between tissue compartments without affecting total body iron.

The tissue-specific effects of RNF217 observed in conditional knockout models suggest that targeted approaches affecting specific cell types (intestinal cells versus macrophages) might provide more precise control over iron parameters than systemic interventions .

How might RNF217 contribute to the pathophysiology of inflammation-associated anemia?

Inflammation-associated anemia (also known as anemia of inflammation or anemia of chronic disease) involves hepcidin-mediated iron sequestration in macrophages, limiting iron availability for erythropoiesis. RNF217's role in this pathophysiology warrants investigation based on several observations:

  • Inflammatory stimuli (LPS) impact RNF217-dependent pathways, as demonstrated in conditional knockout models .

  • RNF217 mediates FPN degradation in macrophages, potentially contributing to iron sequestration during inflammation .

  • The Tet1-RNF217-FPN axis may respond differently to inflammatory signals compared to the hepcidin-FPN pathway, providing multiple regulatory layers.

Researchers investigating this question should consider examining RNF217 expression and activity in models of inflammation-associated anemia, potentially identifying whether RNF217 inhibition could alleviate macrophage iron sequestration independently of or synergistically with anti-hepcidin approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.