Recombinant Human Probable ergosterol biosynthetic protein 28 (C14orf1)

Shipped with Ice Packs
In Stock

Description

Sterol Biosynthesis

  • Acts as a scaffold for sterol C4-demethylase enzymes in yeast (Saccharomyces cerevisiae), facilitating ergosterol synthesis .

  • In humans, homologs may regulate cholesterol biosynthesis, though direct evidence remains limited .

Protein Trafficking

  • Facilitates endoplasmic reticulum (ER)-to-plasma membrane trafficking of ion channels (e.g., SLO-1 BK channels in C. elegans) .

  • Loss of ERG28 reduces surface expression of channels, suggesting a role in shielding proteins from proteasomal degradation .

Research Applications

Key Uses in Studies

ApplicationProtocol/OutcomeCitations
RNA InterferencesiRNA-mediated knockdown reduces ergosterol synthesis in yeast and alters sterol profiles .
Antibody ProductionRabbit polyclonal antibodies (targeting internal/C-terminal regions) used for IHC and Western blot .
Protein InteractionYeast two-hybrid systems identify interactions with sterol biosynthetic enzymes (e.g., Erg26p, Erg27p) .

Experimental Notes

  • Storage: Lyophilized powder stable at -20°C/-80°C; avoid repeated freeze-thaw cycles .

  • Reconstitution: Use Tris/PBS buffer with 6% trehalose; glycerol (5–50%) recommended for long-term storage .

Evolutionary Conservation

  • Yeast: Erg28p scaffolds ergosterol synthesis enzymes and is critical for growth under sterol-limiting conditions .

  • Plants: Arabidopsis ERG28 homologs regulate polar auxin transport via sterol intermediates .

  • Nematodes: C. elegans ERG-28 diverges functionally but retains a role in ion channel trafficking .

Clinical and Pathological Relevance

  • Cancer: Elevated C14orf1 mRNA levels observed in testicular tumors and cancer cell lines (e.g., HeLa, HepG2) .

  • Neurological Disorders: Human ERG28 interacts with CLN8, a protein linked to neuronal ceroid lipofuscinosis .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of that specified tag.
Synonyms
ERG28; C14orf1; AD-011; HSPC288; x0006; Ergosterol biosynthetic protein 28 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ERG28
Target Protein Sequence
MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLS SVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILG MLVGLRYLEVEPVSRQKKRN
Uniprot No.

Target Background

Gene References Into Functions
  1. Data indicate that integrin beta6, CD46, tissue factor, and chromosome 14 open reading frame 1 (C14ORF1), were identified as overexpressed on pancreatic cancer cell lines. PMID: 21934552
Database Links

HGNC: 1187

OMIM: 604576

KEGG: hsa:11161

STRING: 9606.ENSP00000256319

UniGene: Hs.15106

Protein Families
ERG28 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous; strongly expressed in testis and some cancer cell lines.

Q&A

What is the subcellular localization of ERG28, and how can it be validated experimentally?

ERG28 is primarily localized to the endoplasmic reticulum (ER) membrane. This has been experimentally validated using fluorescent protein tagging techniques. For example, researchers have fused ERG28 to green fluorescent protein (ERG28-GFP) and used established ER markers like RTNLB2-GFP to confirm co-localization to the ER, which is the main site of sterol biosynthesis . This approach confirmed that ERG28 specifically localizes to the endoplasmic reticulum in plant studies.

For validation in mammalian cells, researchers typically use:

  • Confocal microscopy with co-staining of established ER markers

  • Cell fractionation followed by western blot analysis

  • Immunogold electron microscopy for ultrastructural confirmation

How does ERG28 function as a scaffold in sterol biosynthesis?

ERG28 functions as a scaffold protein in the endoplasmic reticulum that tethers the sterol C4-demethylation complex (SC4DM) component enzymes . This tethering role facilitates the sequential transfer of C4-methyl sterol biosynthetic intermediates (SBIs) among the different enzymes of the complex.

The scaffolding function has been experimentally demonstrated through:

  • Pull-down assays showing ERG28 binds to SC4DM enzymes including SMO1, CSD, and SKR

  • Complementation studies where Arabidopsis ERG28 functionally complemented the yeast erg28 mutant, restoring the wild-type ergosterol pathway

  • Direct demonstration using biotinylated ERG28 attached to streptavidin-agarose to pull down recombinant SC4DM complex components

How can researchers generate ERG28 knockout cell lines to study its function in cholesterol biosynthesis?

Researchers have successfully generated ERG28 knockout cell lines (particularly in Huh7 cells) to investigate its role in cholesterol biosynthesis. The methodological approach includes:

  • Design of targeting constructs or CRISPR/Cas9 guide RNAs specific to the ERG28 locus

  • Transfection of cells followed by selection of potential knockout clones

  • Validation of knockout through:

    • RT-PCR and qRT-PCR analysis to confirm reduced mRNA levels

    • Immunoblot analysis to confirm absence of ERG28 protein

    • Sequencing to confirm genetic modifications

Analysis of these knockout lines revealed:

  • Reduced total cholesterol levels in sterol-depleted environments

  • A 60-75% reduction in the rate of cholesterol synthesis compared to wild-type cells

  • Impaired activation of SREBP-2 under sterol-replete conditions

Rescue experiments through expression of ectopic ERG28 can confirm the specificity of the knockout phenotypes.

What model organisms provide valuable insights into ERG28 function?

Several model organisms have provided significant insights into ERG28 function:

  • C. elegans:

    • Mutant strains like erg-28(cim16) and erg-28(gk697770) have revealed ERG28's role in BK channel trafficking

    • CRISPR/Cas9 genome editing to generate GFP-tagged SLO-1 lines has enabled in vivo visualization of trafficking defects

    • Behavioral phenotypes (e.g., locomotion, ethanol response) provide functional readouts for ERG28 activity

  • Arabidopsis thaliana:

    • RNAi knockdown and T-DNA knockout lines demonstrate ERG28's role in sterol metabolism and auxin transport

    • Expression pattern analysis shows developmental and tissue-specific regulation

  • Saccharomyces cerevisiae:

    • The erg28 yeast mutant accumulates characteristic sterol intermediates

    • Complementation studies with ERG28 from other species test functional conservation

What mechanisms explain ERG28's dual role in sterol biosynthesis and ion channel trafficking?

ERG28 appears to have evolved distinct but potentially interconnected functions:

  • Sterol biosynthesis role: ERG28 tethers the sterol C4-demethylation enzyme complex components in the ER membrane . This classical function is conserved across species capable of de novo sterol synthesis.

  • Ion channel trafficking role: In C. elegans, ERG28 promotes the trafficking of SLO-1 BK channels from the ER to the plasma membrane .

Possible mechanistic explanations for this dual functionality include:

Research methodologies to explore this dual role further:

  • Domain-specific mutations to identify regions required for each function

  • Interactome analysis using proximity labeling techniques like BioID or APEX

  • Structure-function analysis through cryo-EM or crystallography

How do evolutionary changes in ERG28 across species inform functional studies?

ERG28 shows interesting evolutionary patterns that provide insights into its function:

  • Conservation pattern: While the primary sequence is well conserved in organisms able to synthesize sterols de novo, strong divergence is observed in insects, which are cholesterol auxotrophs .

  • Functional implications: The accelerated evolution of insect ERG28 homologs followed by stabilization suggests ERG28 likely plays roles in at least two different pathways. When cholesterol synthesis was discontinued in insects, the protein was free to evolve as long as its function in other pathways wasn't compromised .

  • Cross-species complementation: Human C14orf1 can partially replace C. elegans ERG-28 function, suggesting functional conservation despite sequence divergence .

Research approaches to leverage evolutionary insights:

  • Compare domain conservation across species to identify functional motifs

  • Test cross-species complementation of specific functions (e.g., sterol synthesis vs. channel trafficking)

  • Identify species-specific interacting partners that may explain functional differences

What experimental techniques are most effective for studying ERG28's protein interactions?

Several complementary techniques have proven effective for studying ERG28's interactions:

  • Co-immunoprecipitation:

    • Expression of tagged SC4DM components (SMO1-GFP, CSD-GFP, SKR-GFP) followed by pull-down with anti-ERG28 antibody

    • Reverse approach using anti-GFP antibodies to pull down ERG28

  • Direct pull-down assays:

    • Biotinylated ERG28 attached to streptavidin-agarose used to pull down recombinant SC4DM components

    • This approach directly demonstrates binary interactions without cellular context

  • In vivo imaging:

    • Co-localization studies using fluorescently tagged proteins

    • FRET or BiFC approaches to verify proximity of interaction partners

  • Genetic approaches:

    • Suppressor screens in model organisms (as done in C. elegans to identify erg-28 as a regulator of SLO-1 function)

    • Synthetic genetic arrays to identify genetic interactions

How can researchers track ERG28-mediated protein trafficking in vivo?

Researchers have successfully tracked ERG28's role in protein trafficking using several approaches:

  • Endogenous tagging strategies:

    • CRISPR/Cas9 genome editing to fuse GFP to the C-terminus of trafficking cargo (e.g., SLO-1::GFP)

    • Verification that tagged proteins maintain normal function through behavioral assays

  • Quantitative imaging:

    • Measuring fluorescence intensity of tagged cargo proteins in wild-type versus erg-28 mutant backgrounds

    • Comparing subcellular distribution patterns to identify trafficking defects

  • Rescue experiments:

    • Expressing mCherry-tagged ERG28 under its own promoter in erg-28 mutants to restore trafficking

    • Tissue-specific expression to determine where ERG28 function is required

  • Biochemical validation:

    • Western blot analysis to measure total levels of cargo proteins

    • Cell surface biotinylation to specifically quantify plasma membrane-localized proteins

How can researchers distinguish between direct and indirect effects of ERG28 on target proteins?

Distinguishing direct from indirect effects of ERG28 requires multiple complementary approaches:

  • Temporal analysis:

    • Acute versus chronic depletion (e.g., RNAi knockdown versus genetic knockout)

    • Time-course studies after inducible ERG28 manipulation

  • Domain-specific mutations:

    • Creating ERG28 variants that selectively disrupt specific interactions

    • Testing these variants for rescue of different phenotypes

  • Direct binding studies:

    • In vitro binding assays with purified components

    • Surface plasmon resonance or isothermal titration calorimetry to measure binding affinities

  • Proximity labeling techniques:

    • BioID or APEX2 fusion to ERG28 to identify proteins in close proximity in vivo

    • Comparison with control proximity labeling to identify specific interactions

What controls are necessary when evaluating ERG28's effect on protein trafficking?

Critical controls for trafficking studies include:

  • Functional validation of tagged proteins:

    • Behavioral assays to ensure tagged proteins (e.g., SLO-1::GFP) function normally

    • Electrophysiological recordings to verify channel activity

  • Multiple cargo proteins:

    • Testing ERG28's effect on trafficking of multiple proteins to distinguish specific from general effects

    • Including known ER-resident proteins as negative controls

  • Rescue experiments:

    • Expression of wild-type ERG28 in mutant backgrounds to confirm specificity

    • Cross-species complementation tests (e.g., human C14orf1 in C. elegans)

  • Organelle markers:

    • Co-localization with markers for different compartments (ER, Golgi, endosomes)

    • Quantification of co-localization using appropriate statistical methods

How might ERG28's dual function in sterol metabolism and protein trafficking be exploited in disease models?

ERG28's role in both sterol metabolism and protein trafficking suggests several potential research directions in disease models:

  • Neurodegenerative diseases:

    • Many neurodegenerative conditions feature defects in both lipid metabolism and protein trafficking

    • Investigation of ERG28's role in trafficking of disease-associated proteins (e.g., APP in Alzheimer's)

    • Examination of whether alterations in sterol composition affect protein trafficking

  • Metabolic disorders:

    • ERG28 knockout cells show reduced cholesterol synthesis and impaired SREBP-2 activation

    • Potential role in metabolic syndrome, non-alcoholic fatty liver disease, or other disorders of lipid metabolism

  • Ion channelopathies:

    • ERG28's role in BK channel trafficking suggests it might influence trafficking of other ion channels

    • Investigation in models of epilepsy, cardiac arrhythmias, or other channelopathies

What systems biology approaches could better elucidate ERG28's role in cellular homeostasis?

Integrative approaches to better understand ERG28 function include:

  • Multi-omics integration:

    • Combination of transcriptomics, proteomics, and lipidomics in ERG28 manipulation models

    • Network analysis to identify coordinated changes in multiple pathways

  • Spatial proteomics:

    • Comprehensive subcellular localization mapping of proteins in normal vs. ERG28-deficient cells

    • Identification of proteins whose localization depends on ERG28

  • Computational modeling:

    • Simulation of sterol biosynthetic pathways with and without ERG28 scaffolding function

    • Models integrating membrane composition and protein trafficking dynamics

  • High-content screening:

    • Systematic testing of small molecule modulators of ERG28 function

    • Phenotypic profiling across multiple cellular processes to uncover new functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.