Recombinant Human Probable G-protein coupled receptor 123 (GPR123)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will then prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADGRA1; GPR123; KIAA1828; Adhesion G protein-coupled receptor A1; G-protein coupled receptor 123
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-560
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDLKTVLSLPRYPGEFLHPVVYACTAVMLLCLLASFVTYIVHQSAIRISRKGRHTLLNFC FHAALTFTVFAGGINRTKYPILCQAVGIVLHYSTLSTMLWIGVTARNIYKQVTKKAPLCL DTDQPPYPRQPLLRFYLVSGGVPFIICGVTAATNIRNYGTEDEDTAYCWMAWEPSLGAFY GPAAIITLVTCVYFLGTYVQLRRHPGRRYELRTQPEEQRRLATPEGGRGIRPGTPPAHDA PGASVLQNEHSFQAQLRAAAFTLFLFTATWAFGALAVSQGHFLDMVFSCLYGAFCVTLGL FVLIHHCAKREDVWQCWWACCPPRKDAHPALDANGAALGRAACLHSPGLGQPRGFAHPPG PCKMTNLQAAQGHASCLSPATPCCAKMHCEPLTADEAHVHLQEEGAFGHDPHLHGCLQGR TKPPYFSRHPAEEPEYAYHIPSSLDGSPRSSRTDSPPSSLDGPAGTHTLACCTQGDPFPM VTQPEGSDGSPALYSCPTQPGREAALGPGHLEMLRRTQSLPFGGPSQNGLPKGKLLEGLP FGTDGTGNIRTGPWKNETTV
Uniprot No.

Target Background

Function
Orphan receptor.
Gene References Into Functions
  1. Studies suggest that the orthologs of GP123 in mouse and rat play a role in the regulation of neuronal signaling pathways. PMID: 17212699
Database Links

HGNC: 13838

OMIM: 612302

KEGG: hsa:84435

STRING: 9606.ENSP00000376384

UniGene: Hs.435183

Protein Families
G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is GPR123 and what classification system applies to this receptor?

GPR123 (Gene/Protein name) is classified as an adhesion G protein-coupled receptor A1 (ADGRA1) according to current nomenclature. It belongs to the adhesion GPCR subfamily, which has undergone significant reclassification in recent years . The receptor features a seven-transmembrane domain characteristic of GPCRs but with distinctive adhesion-specific structural elements. Recent phylogenetic analysis has revealed inconsistencies in the traditional numerical grouping of adhesion GPCRs, as the branch lengths within and between groups do not serve as reliable discriminators for classification . Current classification schemes are under ongoing refinement, with issues noted regarding the numerical ordering of members that doesn't accurately reflect their phylogenetic relationships .

What expression systems are most suitable for recombinant GPR123 production?

Mammalian expression systems are highly recommended for recombinant GPR123 production due to their capacity to perform proper post-translational modifications essential for GPCR functionality. The human embryonic kidney 293 (HEK293) cell line is among the most popular choices for human GPCRs, offering capabilities for both transient and stable expression . While non-mammalian systems generally provide higher yields, mammalian systems better ensure functional expression with proper folding and trafficking .

For GPR123 expression, the following systems can be considered:

Expression SystemAdvantagesDisadvantagesRecommendation Level
HEK293 (adherent)Proper folding, post-translational modificationsLower yieldHigh
HEK293 (suspension)Higher cell density, increased yieldMore complex culture conditionsHigh
Other mammalian linesTissue-specific processingVariable expression levelsMedium
Non-mammalian systemsHigher yieldPotentially non-functional proteinLow

The choice should be guided by the specific experimental requirements, with HEK293 cells being particularly valuable as evidenced by their use in determining 3D structures of numerous GPCRs .

How can I optimize my expression construct for successful GPR123 production?

Optimizing your GPR123 expression construct requires attention to several key elements:

  • Codon optimization: Though yields may be higher in non-mammalian systems, codon optimization for mammalian expression is crucial for functional GPR123 production .

  • Signal sequences: Incorporation of a Kozak sequence (GCCACCATGG) and signal peptide at the 5' end can significantly enhance protein expression and cell surface delivery .

  • Fusion tags: Consider N-terminal tagging strategies such as FLAG epitope tags, which are commonly used for detection without significant interference with function .

  • Vector selection: Utilize mammalian expression vectors with appropriate promoters (such as CMV) for strong expression .

  • Selectable markers: Include selectable markers (e.g., Neomycin/G418 resistance) to establish stable cell lines if needed .

The GPR123-Tango plasmid (#66311) provides an example of an optimized construct, featuring CMV promoter-driven expression, an N-terminal FLAG tag, and a Neomycin selection marker .

What purification strategies should be employed for recombinant GPR123?

Purification of GPR123, like other membrane-bound GPCRs, presents significant challenges requiring specialized approaches:

  • Membrane solubilization: Traditional detergent-based methods and newer styrene maleic acid (SMA) co-polymer techniques should be considered . SMA co-polymers can extract membrane proteins with their native lipid environment intact, potentially preserving functionality.

  • Affinity chromatography: Utilize the N-terminal FLAG tag in GPR123-Tango constructs for initial capture via anti-FLAG affinity purification .

  • Size exclusion chromatography: Apply as a secondary purification step to isolate properly folded receptor from aggregates and obtain a homogeneous preparation.

  • Functional verification: Implement ligand binding assays or NanoBRET assays to confirm that purified receptor maintains its functional properties .

A robust purification workflow should include quality control steps at each stage to monitor receptor integrity, purity, and functional status. Success in GPCR purification often necessitates significant optimization of detergent types, concentrations, and buffer compositions specific to the target receptor.

How do transcript variants impact GPR123 expression and function?

Transcript variants significantly influence GPR123 expression and structure based on recent analysis of aGPCR transcriptome data. Research has revealed an average of 24 different transcript variants for each of the 33 human aGPCR genes, with many dominant transcript variants remaining unannotated . Approximately 60% (median) of identified aGPCR transcript variants were not previously annotated in the NCBI genome database .

These variations have profound implications for GPR123 research:

  • Alternative splicing events (e.g., alternative donor/acceptor sites, exon skipping, cryptic intron usage), variable 5' promoters, internal promoters, and chimeric transcripts can generate diverse GPR123 variants .

  • Tissue-specific expression of particular transcript variants may explain tissue-specific phenotypes and responses to targeting compounds .

  • Variations in exon composition directly affect receptor protein structure, potentially altering ligand binding sites or signal transduction mechanisms .

Notably, analysis of aGPCR genes (the family to which GPR123 belongs) led to the discovery of ADGRG7/GPR128, the first GPCR with eight transmembrane helices rather than the canonical seven . This highlights the potential for structural diversity within this receptor family.

What methods can validate proper folding and trafficking of recombinant GPR123?

Validating proper folding and trafficking of recombinant GPR123 requires multiple experimental approaches:

  • Fluorescent protein tagging: C-terminal fusion with GFP or similar fluorescent proteins allows visualization of cellular localization through confocal microscopy.

  • Surface expression quantification: Flow cytometry using antibodies against extracellular epitope tags can quantify cell surface delivery efficiency.

  • Glycosylation analysis: Western blotting with and without endoglycosidase treatment can verify proper post-translational processing.

  • Ligand binding assays: Though challenging for orphan receptors like GPR123, these provide functional validation of proper folding.

  • NanoBRET technology: As mentioned in the literature, GPCRs tagged with NanoLuc at the N-terminus can provide information about ligand binding and protein interactions .

A comprehensive validation strategy would employ multiple techniques to ensure that the recombinant GPR123 not only expresses but also achieves its native conformation and cellular localization.

What strategies exist for overcoming expression challenges specific to GPR123?

Expression of functional GPR123 encounters several receptor-specific challenges that require advanced strategies:

  • Fusion protein approaches: Consider fusion partners like T4 lysozyme or thermostabilized proteins that have successfully enhanced expression and stability of other difficult-to-express GPCRs.

  • Directed evolution: Implement directed evolution strategies to select for GPR123 variants with improved folding and expression characteristics while maintaining functional properties.

  • Baculovirus expression system optimization: For higher-yield expression, baculovirus systems with modified signal sequences and chaperone co-expression may improve functional expression.

  • Inducible expression systems: Utilize tetracycline-inducible or similar controlled expression systems to mitigate potential cytotoxicity during high-level expression.

  • Co-expression with interacting partners: Expression alongside known interacting proteins or signaling components may enhance stability and functional expression.

The selection of an appropriate strategy depends on the specific experimental goals, whether structural studies requiring large protein quantities or functional studies necessitating proper activity.

How can transcript variant analysis inform GPR123 functional studies?

Advanced transcript variant analysis can significantly enhance GPR123 functional studies in several ways:

  • Tissue-specific targeting: The publicly available Splice-O-Mat application (https://tools.hornlab.org/Splice-O-Mat/) allows researchers to analyze GPR123 transcript variants across 48 human tissues, enabling the design of experiments that target the most relevant variants for specific tissues .

  • Structural predictions: Variations in exon composition can affect domain architecture of the N- and C-termini and the seven-transmembrane domain, potentially creating receptors with distinct signaling properties .

  • Disease-relevant mutations: Assessing tissue-specific transcript variants can transform the evaluation of disease-causing mutations, as their position within different transcript variants may explain tissue-specific phenotypes .

  • Internal promoter analysis: Investigation of internal promoters within the GPR123 gene could reveal N-terminally truncated protein variants with altered function .

The most effective approach involves integrating transcript variant data with functional assays to correlate structural variations with distinct signaling properties or ligand specificities.

What are the current strategies for structural determination of GPR123?

Structural determination of GPCRs like GPR123 represents a significant challenge requiring sophisticated approaches:

  • Cryo-electron microscopy (cryo-EM): Increasingly the method of choice for GPCR structure determination, cryo-EM can resolve structures without the need for crystallization, particularly valuable for conformationally flexible receptors.

  • X-ray crystallography: While challenging for GPCRs, advances in protein engineering, including fusion partners and conformational stabilization, have enabled successful crystallization of numerous GPCRs.

  • Styrene maleic acid lipid particles (SMALPs): This emerging technique allows purification of GPCRs within their native lipid environment, potentially preserving structural integrity for subsequent analysis .

  • Molecular dynamics simulations: Computational approaches can complement experimental structural data to model dynamic behaviors and ligand interactions.

  • NMR spectroscopy: Though challenging for full-length GPCRs, this technique can provide valuable information about specific domains or ligand interactions.

The most productive strategy typically involves a combination of these approaches, with initial focus on expression optimization and stabilization before proceeding to structural studies.

How does GPR123 function within the broader context of adhesion GPCRs?

GPR123/ADGRA1 functions within the complex adhesion GPCR family, which is characterized by unique structural and functional properties:

  • Phylogenetic context: Recent reassessment of adhesion GPCR classification has revealed limitations in the current grouping system, as many group-separating nodes lack significant bootstrap support (<90%) . This suggests GPR123's functional relationships with other family members may require reevaluation.

  • Structural organization: Like other adhesion GPCRs, GPR123 likely features an extended N-terminal extracellular domain involved in adhesion functions and a seven-transmembrane domain mediating signaling .

  • Activation mechanisms: The receptor may function through mechanisms common to adhesion GPCRs, potentially including autoproteolysis at a GPCR proteolysis site (GPS) and tethered agonist signaling.

  • Signal transduction: Though specific signaling pathways for GPR123 remain under investigation, the PRESTO-Tango system (as reflected in the GPR123-Tango plasmid) enables analysis of arrestin-dependent signaling .

Understanding GPR123 within this broader functional context is essential for developing targeted research strategies and interpreting experimental results accurately.

How can functional assays be optimized for studying GPR123 signaling?

Optimizing functional assays for GPR123 signaling requires specialized approaches tailored to its properties as an adhesion GPCR:

  • PRESTO-Tango assay: The GPR123-Tango plasmid system enables "parallel receptorome expression and screening via transcriptional output, with transcriptional activation following arrestin translocation" . This provides a valuable readout for receptor activation and arrestin recruitment.

  • G-protein coupling analysis: BRET-based or FRET-based sensors can detect interactions between GPR123 and various G-protein subtypes to elucidate coupling preferences.

  • Second messenger assays: Measurements of cAMP, calcium flux, or inositol phosphate production can reveal downstream signaling pathways activated by GPR123.

  • Adhesion assays: Given its classification as an adhesion GPCR, cell-cell and cell-matrix adhesion assays may reveal important functional aspects beyond classical GPCR signaling.

  • Mutational analysis: Targeted mutations of conserved motifs, particularly in the transmembrane domains and intracellular loops, can identify regions critical for signaling functions.

Integration of multiple assay types provides the most comprehensive picture of GPR123 signaling capabilities and regulatory mechanisms.

What are the implications of GPR123 research for understanding GPCR biology and disease?

GPR123 research has significant implications for both fundamental GPCR biology and disease understanding:

  • Expanded GPCR structural paradigms: Studies of adhesion GPCRs like GPR123 challenge traditional GPCR structural models, as evidenced by the discovery of the first eight-transmembrane GPCR (ADGRG7/GPR128) within this family .

  • Novel drug targeting approaches: As part of the Illuminating the Druggable Genome (IDG) program, GPR123-Tango was developed to enable discovery of compounds targeting understudied GPCRs . This supports exploration of previously untapped therapeutic opportunities.

  • Disease associations: Variations in transcript composition may explain tissue-specific disease phenotypes associated with GPR123 mutations .

  • Complex signaling networks: GPR123 likely participates in signaling networks beyond classical G-protein pathways, including arrestin-mediated signaling as targeted by the Tango system .

The continued investigation of GPR123 contributes to the broader effort to understand the full spectrum of GPCR diversity and function, particularly within the adhesion GPCR subfamily that remains less characterized than rhodopsin-like GPCRs.

What are the current limitations in GPR123 research and how might they be addressed?

Current GPR123 research faces several significant limitations that require innovative solutions:

  • Orphan receptor status: The endogenous ligand(s) for GPR123 remain unidentified, complicating functional studies. High-throughput screening approaches using the GPR123-Tango system may facilitate ligand discovery .

  • Limited structural information: No high-resolution structure exists for GPR123. Application of emerging technologies like cryo-EM combined with SMALPs could overcome this limitation .

  • Transcript variant complexity: The extensive variety of transcript variants (averaging 24 per aGPCR gene) complicates interpretation of experimental results . Comprehensive transcript analysis using tools like Splice-O-Mat can help address this challenge.

  • Functional redundancy: Potential functional overlap with other adhesion GPCRs may mask phenotypes in knockout models. Combinatorial approaches targeting multiple related receptors might clarify specific functions.

  • Technical challenges in expression and purification: Development of specialized detergents or nanodiscs tailored to GPR123's specific properties could improve purification yields while maintaining functionality .

Addressing these limitations requires interdisciplinary approaches combining genomics, structural biology, pharmacology, and cell biology techniques.

How might emerging technologies advance GPR123 research?

Several emerging technologies hold particular promise for advancing GPR123 research:

  • CRISPR-Cas9 genome editing: Precise modification of GPR123 in cellular and animal models enables detailed structure-function studies and disease modeling.

  • Single-cell transcriptomics: This technology can reveal cell type-specific expression patterns of GPR123 transcript variants, providing insights into specialized functions.

  • AlphaFold and other AI-based structure prediction: These computational approaches may generate useful structural models of GPR123 to guide experimental design before high-resolution experimental structures are available.

  • Optogenetic and chemogenetic tools: Development of light-activated or designer drug-activated versions of GPR123 would allow temporal control of receptor activation for mechanistic studies.

  • Native mass spectrometry: This technique can analyze intact protein complexes, potentially revealing GPR123 interaction partners that influence its function and regulation.

Integration of these technologies with traditional approaches will significantly accelerate understanding of GPR123 biology and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.