Recombinant Human Probable G-protein coupled receptor 128 (GPR128)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ADGRG7; GPR128; Adhesion G-protein coupled receptor G7; G-protein coupled receptor 128
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-797
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
LGIWRIVIRIQRGKSTSSSSTPTEFCRNGGTWENGRCICTEEWKGLRCTIANFCENSTYM GFTFARIPVGRYGPSLQTCGKDTPNAGNPMAVRLCSLSLYGEIELQKVTIGNCNENLETL EKQVKDVTAPLNNISSEVQILTSDANKLTAENITSATRVVGQIFNTSRNASPEAKKVAIV TVSQLLDASEDAFQRVAATANDDALTTLIEQMETYSLSLGNQSVVEPNIAIQSANFSSEN AVGPSNVRFSVQKGASSSLVSSSTFIHTNVDGLNPDAQTELQVLLNMTKNYTKTCGFVVY QNDKLFQSKTFTAKSDFSQKIISSKTDENEQDQSASVDMVFSPKYNQKEFQLYSYACVYW NLSAKDWDTYGCQKDKGTDGFLRCRCNHTTNFAVLMTFKKDYQYPKSLDILSNVGCALSV TGLALTVIFQIVTRKVRKTSVTWVLVNLCISMLIFNLLFVFGIENSNKNLQTSDGDINNI DFDNNDIPRTDTINIPNPMCTAIAALLHYFLLVTFTWNALSAAQLYYLLIRTMKPLPRHF ILFISLIGWGVPAIVVAITVGVIYSQNGNNPQWELDYRQEKICWLAIPEPNGVIKSPLLW SFIVPVTIILISNVVMFITISIKVLWKNNQNLTSTKKVSSMKKIVSTLSVAVVFGITWIL AYLMLVNDDSIRIVFSYIFCLFNTTQGLQIFILYTVRTKVFQSEASKVLMLLSSIGRRKS LPSVTRPRLRVKMYNFLRSLPTLHERFRLLETSPSTEEITLSESDNAKESI
Uniprot No.

Target Background

Function
Orphan receptor.
Gene References Into Functions
  1. An in-frame TRK-fused gene-G-protein-coupled receptor GPR128 was identified in healthy individuals and patients with myeloproliferative neoplasms. PMID: 19797732
Database Links

HGNC: 19241

OMIM: 612307

KEGG: hsa:84873

STRING: 9606.ENSP00000273352

UniGene: Hs.334511

Protein Families
G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is GPR128 and what is its alternative nomenclature?

GPR128, officially designated as ADGRG7, is a member of the Adhesion family of G-protein-coupled receptors (GPCRs). It is specifically identified by gene ID 84873 and accession number NM_032787 . The protein belongs to several functional families including transmembrane proteins, the druggable genome, and the broader GPCR superfamily . As an adhesion GPCR, it contains characteristic structural elements including a GPS (GPCR proteolysis site) domain and a seven-transmembrane (7TM) domain that are critical for its function .

What is the tissue distribution pattern of GPR128 expression?

GPR128 exhibits a highly specific expression pattern in mammalian tissues. Multiple independent detection methods including semi-quantitative reverse transcription-PCR, Northern blotting, and immunofluorescence staining have consistently shown that GPR128 mRNA and protein are highly and exclusively expressed in intestinal tissues . Within the digestive tract, GPR128 expression is prominently detected in both the small intestine and colon, with expression observable from postnatal day 0 through adulthood (at least 8 weeks) . At the cellular level, immunofluorescence staining has revealed that GPR128 protein expression is confined to the intestinal mucosa, specifically within epithelial cells .

What methods are recommended for detecting GPR128 expression in tissues?

For comprehensive GPR128 expression analysis, researchers should implement a multi-method approach:

  • Semi-quantitative RT-PCR: Can be performed using specific primers. For instance, successful amplification has been achieved with forward primer 5'-GATTCCAACTTCATTACTCTG-3' and reverse primer 5'-GGTCCATATCTGCCCACTG-3' (25 cycles), with β-actin as control .

  • Northern blotting: Provides confirmation of transcript size and relative abundance across tissues.

  • Immunofluorescence staining: Enables visualization of protein localization at the cellular level, particularly useful for confirming GPR128's restriction to epithelial cells in the intestinal mucosa .

  • Real-time quantitative PCR (RT-qPCR): Offers more precise quantification of expression levels across different tissues and developmental stages .

When designing primers, the unique structure of adhesion GPCRs should be considered, focusing on regions that distinguish GPR128 from other family members.

What phenotypes have been observed in GPR128 knockout mouse models?

GPR128 knockout mice exhibit several distinct phenotypes that provide insight into the receptor's physiological functions:

  • Reduced body weight gain: GPR128(+/+) mice gained significantly more weight than GPR128(-/-) mice by 24 weeks of age (30.81 ± 2.84 g versus 25.74 ± 4.50 g, respectively; n = 10, P < 0.01) .

  • Increased intestinal motility: The frequency of small intestinal peristaltic contraction was markedly increased in GPR128(-/-) mice compared to wild-type counterparts. This effect was observed at both 8 and 32 weeks of age .

  • Altered slow wave potential: The frequency of slow wave potential in GPR128(-/-) intestine was significantly higher than in wild-type intestine across multiple intraluminal pressure measurements .

The following table summarizes the key differences in intestinal motility between wild-type and GPR128(-/-) mice:

ParameterAgeConditionWild-type (n=8)GPR128(-/-) (n=8)Significance
Peristaltic contraction frequency8 weeks3 cmH₂O2.6 ± 1.7 contractions/15 min6.6 ± 2.3 contractions/15 minP < 0.05
Peristaltic contraction frequency32 weeks2 cmH₂O4.6 ± 2.3 contractions/15 min8.3 ± 3.0 contractions/15 minP < 0.05
Peristaltic contraction frequency32 weeks3 cmH₂O3.1 ± 0.8 contractions/15 min7.4 ± 3.1 contractions/15 minP < 0.01
Slow wave potential frequency32 weeks1 cmH₂O30.6 ± 4.2/min35.8 ± 4.3/minP < 0.05
Slow wave potential frequency32 weeks2 cmH₂O31.4 ± 3.9/min36.4 ± 4.2/minP < 0.05
Slow wave potential frequency32 weeks3 cmH₂O31.9 ± 4.5/min37.1 ± 4.8/minP < 0.05

What are the optimal methods for generating a GPR128 knockout model?

Based on successful previous approaches, the recommended methodology for generating a GPR128 knockout model includes:

  • Targeting vector construction: Using bacterial artificial chromosome-retrieval methods to construct the targeting vector. The critical design involves replacing exons that encode essential functional domains .

  • Strategic exon deletion: Target exons 10, 11, and 12, which encode the GPS domain and a portion of the 7TM domain, for replacement with a selection cassette (e.g., PGK cassette followed by neomycin resistance gene) .

  • Homologous recombination: Electroporating embryonic stem (ES) cells with the linearized targeting vector under positive-negative selection to identify targeted ES clones by PCR .

  • Chimera generation: Microinjecting properly targeted ES clones into C57BL/6 blastocysts to obtain chimeras .

  • Genotyping: Developing a robust PCR-based genotyping strategy for identifying wild-type (+/+), heterozygous (+/-), and homozygous (-/-) mice. Previous successful designs amplified wild-type and targeted alleles producing bands of 5.4 and 5.7 kb, respectively .

  • Validation: Confirming knockout status through semi-quantitative RT-PCR and immunofluorescence staining of intestinal tissues to verify absence of GPR128 expression .

How does GPR128 influence intestinal motility and peristaltic contraction?

GPR128 plays a significant regulatory role in intestinal motility, as evidenced by the phenotype of knockout models. The precise mechanisms involve:

  • Regulation of slow wave potentials: GPR128(-/-) mice demonstrate significantly increased frequency of slow wave potentials in the intestine (approximately 15-16% higher than wild-type counterparts) across multiple intraluminal pressure conditions . This suggests GPR128 may function as an endogenous inhibitor of intestinal pacemaker activity.

  • Modulation of peristaltic contraction: The absence of GPR128 results in a 2-3 fold increase in peristaltic contraction frequency, indicating a substantial inhibitory function of this receptor in normal intestinal physiology .

  • Age-dependent effects: The effects on intestinal motility are observable at both young (8 weeks) and mature (32 weeks) ages, suggesting GPR128's regulatory function is maintained throughout adulthood .

To investigate these mechanisms, the Trendelenburg preparation methodology has proven effective, allowing direct measurement of intestinal motility parameters under controlled intraluminal pressure conditions . When designing similar experiments, researchers should consider measuring both mechanical contraction frequency and electrical slow wave potentials to comprehensively assess GPR128's impact on intestinal function.

What is the relationship between GPR128 and body weight regulation?

GPR128 appears to play a significant role in body weight regulation, as evidenced by the reduced weight gain in knockout mice. The relationship involves several aspects:

  • Long-term weight divergence: GPR128(+/+) and GPR128(-/-) mice show comparable weights early in life, but significant divergence becomes apparent by 24 weeks of age, with knockout mice weighing approximately 16% less than wild-type counterparts (25.74 ± 4.50 g versus 30.81 ± 2.84 g) .

  • Mechanism hypothesis: The observed increased intestinal motility in knockout mice may contribute to reduced nutrient absorption efficiency, potentially explaining the reduced weight gain .

  • Therapeutic implications: Given these findings, GPR128 represents a potential therapeutic target for obesity management, as its inhibition may promote weight loss through altered gastrointestinal physiology rather than through central appetite regulation mechanisms .

When investigating this relationship, researchers should design longitudinal studies tracking body weight, food intake, fecal output, and nutrient absorption efficiency to fully characterize the metabolic consequences of GPR128 modulation.

How can researchers effectively use recombinant GPR128 in their studies?

For effective utilization of recombinant GPR128 in research, consider the following methodological approaches:

  • Appropriate expression systems: Commercial recombinant GPR128 is available as GFP-tagged human clones in pCMV6-AC-GFP vectors with C-terminal tags, suitable for mammalian expression systems .

  • Recommended applications:

    • Overexpression studies to investigate GPR128 signaling pathways

    • Subcellular localization analysis using the GFP tag

    • Co-immunoprecipitation experiments to identify interaction partners

    • Ligand screening assays

  • Experimental considerations:

    • Optimal storage at -20°C to maintain protein integrity

    • Antibiotic selection using neomycin or ampicillin for stable transfection

    • Verification of expression using anti-GFP antibodies or GPR128-specific antibodies

    • Controls should include empty vector transfections

  • Complementary approaches: Combine recombinant expression with knockout or knockdown models to perform rescue experiments that definitively establish GPR128's functional roles.

What are the challenges in identifying ligands for orphan receptors like GPR128?

Ligand identification for orphan GPCRs like GPR128 presents several methodological challenges:

  • Structural complexity: Adhesion GPCRs typically contain large extracellular domains with multiple potential ligand binding sites, complicating conventional screening approaches.

  • Tissue-specific expression: GPR128's exclusive expression in intestinal tissues suggests potential ligands may be locally produced factors, requiring tissue-specific screening strategies .

  • Activation mechanisms: Unlike conventional GPCRs, adhesion GPCRs may utilize unique activation mechanisms including auto-proteolysis at the GPS domain and tethered agonist activation.

  • Recommended methodological approaches:

    • Targeted screening of intestinal tissue extracts

    • Proximity labeling approaches to identify proteins interacting with GPR128 in native tissues

    • Functional assays measuring known GPR128-dependent phenotypes (intestinal motility)

    • Computational prediction based on structural modeling and evolutionary conservation

  • Validation requirements: Candidate ligands should be validated by demonstrating:

    • Direct binding to GPR128

    • Functional effects in GPR128-expressing cells but not in knockout controls

    • Concentration-dependent effects consistent with physiological relevance

    • Activity in ex vivo intestinal preparations that mimics GPR128 knockout phenotypes

What are the implications of GPR128 research for metabolic and gastrointestinal disorders?

The discovery of GPR128's role in intestinal motility and body weight regulation opens several promising research directions with clinical implications:

  • Obesity treatment: GPR128 antagonists could potentially serve as novel therapeutics for obesity, working through a peripheral mechanism of increased intestinal motility rather than central appetite suppression .

  • Gastrointestinal motility disorders: Conditions characterized by reduced intestinal motility, such as post-operative ileus or chronic constipation, might benefit from therapies targeting GPR128 signaling.

  • Nutrient absorption disorders: Understanding GPR128's influence on intestinal function may provide insights into conditions involving malabsorption or hyperabsorption of nutrients.

  • Personalized medicine approaches: Genetic variations in GPR128 may contribute to individual differences in gastrointestinal function and metabolism, potentially informing personalized treatment strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.