Recombinant Human Probable G-protein coupled receptor 139 (GPR139)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Probable G-protein coupled receptor 139 (GPR139)

Recombinant Human Probable G-protein coupled receptor 139 (GPR139) is a structurally conserved orphan G protein-coupled receptor (GPCR) primarily expressed in the central nervous system, particularly in regions such as the habenula, striatum, hippocampus, locus coeruleus, ventral tegmental area, and dorsal root ganglia . Despite being an orphan receptor, meaning its endogenous ligand is not well-defined, GPR139 has been implicated in various neuropsychiatric processes, including opioid addiction and schizophrenia .

Expression and Function of GPR139

GPR139 is highly enriched in brain regions associated with motivated behaviors, movement control, nociception, and cognition . It has been shown to interact with the μ-opioid system, modulating opioid receptor function . Additionally, GPR139 co-expresses with dopamine D2 receptors in certain brain regions, although not in the same cells in most areas except the anterior lobe of the pituitary gland .

Ligands and Agonists of GPR139

While the endogenous ligand for GPR139 remains unclear, amino acids L-tryptophan (L-Trp) and L-phenylalanine (L-Phe) have been identified as candidate physiologic ligands, activating GPR139 with EC50 values in the range of 30-300 μM . Synthetic agonists like JNJ-63533054 have been developed to study GPR139's function, with this compound being used in clinical trials for cognitive impairment and negative symptoms of schizophrenia .

Research Findings and Clinical Implications

Research using GPR139 agonists and antagonists has provided insights into its role in fear conditioning and neuropsychiatric diseases. For instance, GPR139 agonists have been shown to protect dopamine neurons against toxicity and impair decision-making in zebrafish models of fear conditioning . Additionally, GPR139 antagonists can modulate opioid receptor sensitivity and have potential therapeutic applications in managing opioid addiction .

Table 1: Brain Regions with High Expression of GPR139

Brain RegionExpression Level
HabenulaHigh
StriatumHigh
HippocampusModerate
Locus CoeruleusHigh
Ventral Tegmental AreaHigh
Dorsal Root GangliaHigh

Table 2: Known Ligands and Agonists of GPR139

Ligand/AgonistFunction/Role
L-TryptophanCandidate physiologic ligand
L-PhenylalanineCandidate physiologic ligand
JNJ-63533054Synthetic agonist for clinical trials

Table 3: Clinical Implications of GPR139

Condition/DiseaseRole of GPR139
Opioid AddictionModulates opioid receptor function
SchizophreniaPotential therapeutic target for negative symptoms
Cognitive ImpairmentTarget for therapeutic interventions

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR139; GPRG1; PGR3; Probable G-protein coupled receptor 139; G(q-coupled orphan receptor GPRg1; G-protein-coupled receptor PGR3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MEHTHAHLAANSSLSWWSPGSACGLGFVPVVYYSLLLCLGLPANILTVIILSQLVARRQK SSYNYLLALAAADILVLFFIVFVDFLLEDFILNMQMPQVPDKIIEVLEFSSIHTSIWITV PLTIDRYIAVCHPLKYHTVSYPARTRKVIVSVYITCFLTSIPYYWWPNIWTEDYISTSVH HVLIWIHCFTVYLVPCSIFFILNSIIVYKLRRKSNFRLRGYSTGKTTAILFTITSIFATL WAPRIIMILYHLYGAPIQNRWLVHIMSDIANMLALLNTAINFFLYCFISKRFRTMAAATL KAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDKNGKPIKVSP
Uniprot No.

Target Background

Function
GPR139 is an orphan receptor. It appears to function through a G(q/11)-mediated pathway.
Gene References Into Functions
  1. Molecular cloning of GPRg1, a Gq-coupled orphan receptor expressed in the brain. PMID: 15845401
Database Links

HGNC: 19995

KEGG: hsa:124274

STRING: 9606.ENSP00000458791

UniGene: Hs.446875

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed almost exclusively in the brain. Detected at very low levels in the peripheral tissues.

Q&A

What is the primary tissue distribution pattern of GPR139?

GPR139 exhibits a discrete distribution pattern primarily in the brain, with particularly high expression in the medial habenula. The receptor is selectively expressed in brain circuits involved in controlling movement, motivation, and reward pathways. This specific localization pattern is crucial for understanding its functional relevance in neuropsychiatric processes. Researchers investigating GPR139 should focus their efforts on these brain regions for most relevant experimental outcomes .

What are the endogenous ligands for GPR139?

GPR139 can be activated by the essential amino acids L-tryptophan (L-Trp) and L-phenylalanine (L-Phe), which have EC50 values in the 200-300 μM range. These amino acids are typically present in culture media at concentrations of approximately 20-70 μM, which may enhance basal GPR139 activity in experimental settings . Additionally, some evidence suggests that α-Melanocyte-stimulating hormone (α-MSH) may function as an endogenous agonist, though findings across studies have been inconsistent . When designing experiments to investigate GPR139 function, researchers should account for potential basal activation by these endogenous molecules present in experimental systems .

What G protein signaling pathways does GPR139 activate?

GPR139 functions as a dual-specificity receptor capable of activating multiple G proteins with varying efficacies and kinetics. Primary coupling occurs through the Gq/11 class (specifically Gq and G11), with significant activation also observed across members of the Gi/o class without strong preferences for individual subtypes . Comparative analysis of maximum amplitudes and activation rates reveals a unique fingerprint-like profile of GPR139 coupling preferences . Notably, GPR139 does not activate Gs and G12/13 classes . This signaling profile is important to consider when designing pathway-specific experiments or interpreting downstream effects of GPR139 activation .

How do synthetic agonists compare in GPR139 research applications?

Several synthetic agonists have been developed for GPR139 research with distinct properties and applications:

CompoundPropertiesResearch Applications
JNJ-63533054Selective, brain-penetrantBehavioral studies, addiction models
Zelatriazin (TAK-41)Potent, selectiveClinical trials for psychiatric conditions
NBI-1065846Potent, selectiveEvaluated for depression and schizophrenia

JNJ-63533054 has been particularly well-characterized in behavioral models and demonstrated efficacy at 30 mg/kg (but not 10 mg/kg) in reversing alcohol self-administration in dependent rats . Furthermore, it has served as a key reference ligand for structural studies, including cryo-EM characterization of GPR139-G protein complexes .

How does GPR139 interact with the opioid system?

GPR139 demonstrates molecular intertwining with the μ-opioid receptor (MOR) and actively opposes its signaling, suggesting a critical role in regulating reward pathways . The expression pattern of GPR139 correlates with that of MOR across multiple CNS regions, positioning it as a key regulator of opioid signaling . At the cellular level, GPR139's Gq/11 signaling likely interferes with the Gi/o signals generated by MOR, though this interaction may vary depending on neuronal context . This opposition suggests that GPR139 antagonists could potentially enhance behavioral sensitivity to opioids, offering a strategy for increasing the therapeutic window of opioid drugs . Researchers exploring this interaction should consider that GPR139 may similarly interfere with signaling from other Gi/o-coupled receptors co-expressed in the same neurons .

What neuropsychiatric phenotypes emerge in GPR139 knockout models?

Mice with GPR139 null mutations exhibit a complex array of neuropsychiatric manifestations:

  • Delayed-onset hyperactivity

  • Elevated stereotypical behaviors

  • Increased anxiety-related traits

  • Delayed acquisition of operant responsiveness

  • Disruption of cued fear conditioning

  • Social interaction deficits

  • Complete loss of pre-pulse inhibition

  • Development of spontaneous 'hallucinogenic'-like behaviors

These phenotypic alterations suggest a significant role for GPR139 in maintaining normal neuropsychiatric function and indicate its potential relevance to multiple psychiatric conditions . Notably, some of these schizophrenia-like manifestations can be rescued with the dopamine receptor antagonist haloperidol and the μ-opioid receptor antagonist naltrexone, further highlighting the receptor's interactions with these neuromodulatory systems .

What structural characteristics define GPR139?

GPR139 is a protein-coding gene located on chromosome 16 in humans that encodes a G protein-coupled receptor . Structural characterization has been significantly advanced through cryo-electron microscopy (cryo-EM) studies revealing GPR139 in complex with the reference ligand JNJ-63533054 (an analog of clinical candidate TAK-041) and various G proteins . These structures include complexes with miniGs/q or Gi in nucleotide-free form, as well as the GPR139–JNJ-63533054–miniGs/q complex in both GDP- and GTP-bound states . Homology modeling incorporating mutagenesis data has further revealed that gain-of-function mutations typically cluster in or adjacent to the orthosteric ligand binding site, while loss-of-function mutations predominantly affect intracellular G-protein binding regions or disrupt helix integrity .

What methods are effective for screening GPR139 mutants?

To screen GPR139 mutants effectively, researchers have successfully employed a multi-faceted approach:

  • Site-directed and high-throughput random mutagenesis using a double addition normalization strategy to identify sequences with altered ligand sensitivity

  • Calcium mobilization assays to detect functional changes in receptor activity

  • Radioligand binding assays to evaluate ligand-receptor interactions

  • Protein expression assays to confirm proper membrane localization

  • Incorporation of structure-activity data into homology models to visualize spatial relationships between mutations and functional domains

This approach has successfully yielded GPR139 variants with gain-of-function, reduction-of-function, or loss-of-function properties, providing valuable insights into structure-function relationships and facilitating rational design of novel ligands .

How can researchers differentiate between GPR139-mediated Gq/11 and Gi/o signaling pathways?

Distinguishing between GPR139's dual signaling pathways requires a complementary methodological approach:

When interpreting results, researchers must consider that cellular context significantly affects whether Gq/11 and Gi/o pathways display inhibitory or synergistic relationships. The regulation of downstream effector systems may vary considerably across different neuronal populations, making the full extent of GPR139 signaling more nuanced and context-dependent than initially apparent .

What are optimal experimental designs for investigating GPR139's role in addiction mechanisms?

To investigate GPR139's role in addiction, researchers should implement these evidence-based experimental designs:

  • Alcohol dependence models: GPR139 activation via JNJ-63533054 (30 mg/kg) can reverse escalation of alcohol self-administration in dependent rats, providing a validated model system

  • Subject stratification: Analyze effects separately in subgroups of dependent animals, as GPR139 agonists appear particularly effective in subjects exhibiting compulsive-like drinking patterns

  • Behavioral specificity controls: Include assessments of water or saccharin intake in dependent rats and alcohol intake in non-dependent rats to establish specificity of observed effects

  • Withdrawal symptom evaluation: Measure multiple withdrawal parameters, as GPR139 activation reduces withdrawal-induced hyperalgesia without affecting somatic withdrawal signs

  • Site-specific manipulations: Perform microinjections of GPR139 ligands into specific brain regions, as effects have been demonstrated with injections into the habenula but not the interpeduncular nucleus

  • Dose optimization: Establish complete dose-response relationships, noting that significant effects were observed at 30 mg/kg but not 10 mg/kg of JNJ-63533054

These approaches have provided robust preclinical evidence that GPR139 receptor activation can reverse key addiction-like behaviors in dependent animals, suggesting potential therapeutic applications in alcohol use disorder .

How can researchers reconcile conflicting data regarding GPR139's endogenous ligands?

Resolving discrepancies in the literature regarding GPR139's endogenous ligands requires a systematic approach:

  • Concentration considerations: Note that L-Trp and L-Phe have EC50 values in the 200-300 μM range, while existing at approximately 20-70 μM in culture media, which may explain variability in activation patterns across experimental systems

  • Multiple signaling readouts: Since GPR139 activates both Gq/11 and Gi/o pathways, assay selection can significantly impact apparent ligand efficacy; use multiple complementary readouts

  • Standardized expression systems: Control receptor expression levels carefully, as varying expression can shift apparent potency and efficacy values

  • Competitive binding studies: Employ radioligand binding assays to directly compare binding affinities independent of signaling outcomes

  • Native tissue validation: Confirm findings from heterologous systems in tissues with endogenous GPR139 expression, particularly the medial habenula

The conflicting reports regarding α-MSH activation of GPR139, with some studies supporting and others questioning this interaction , highlight the importance of comprehensive validation across multiple experimental platforms before definitively assigning endogenous ligand status to any molecule.

What approaches facilitate development of selective GPR139 antagonists?

Developing selective GPR139 antagonists presents significant challenges, as current compounds exhibit low potency and poor specificity . Researchers should consider these strategies:

  • Structure-based design: Utilize recently reported cryo-EM structures of GPR139-ligand complexes to model potential antagonist binding modes

  • Allosteric modulation: Target non-conserved allosteric sites to achieve greater selectivity than orthosteric antagonists

  • High-throughput screening refinement: Optimize screening libraries with scaffolds known to target Class A GPCRs

  • Mutagenesis insights: Leverage data from gain-of-function and loss-of-function mutations to identify critical binding determinants

  • In vivo validation: Test candidate compounds in GPR139 knockout models to confirm selectivity

Developing potent and selective GPR139 antagonists would be particularly valuable for enhancing behavioral sensitivity to opioids, given the receptor's demonstrated opposition to opioid signaling . Such compounds could potentially increase the therapeutic window of opioid drugs while reducing required dosages .

How should researchers investigate GPR139 interactions with other GPCRs?

Investigating GPR139's interactions with other GPCRs requires sophisticated methodological approaches:

  • Co-expression systems: Establish cell lines expressing GPR139 alongside μ-opioid receptors or dopamine D2 receptors at physiologically relevant ratios

  • Signaling interference studies: Determine how GPR139 activation modifies signaling through co-expressed receptors, particularly focusing on the opposition of Gq/11 signals to Gi/o-coupled receptors

  • Receptor trafficking analysis: Examine whether GPR139 activation affects internalization or membrane expression of interacting receptors

  • Proximity-based assays: Use resonance energy transfer techniques to detect physical interactions or conformational coupling between GPR139 and other GPCRs

  • Pharmacological manipulation: Test how GPR139 agonists modify responses to drugs targeting μ-opioid or dopamine D2 receptors, and vice versa

  • Circuit-level analysis: Investigate whether GPR139's effects require direct receptor interactions or involve circuit-level modulation

These approaches are particularly relevant given evidence that GPR139 is molecularly intertwined with the μ-opioid receptor and functionally opposes its signaling , and potentially interacts with dopamine D2 receptors as well .

What methodological considerations ensure valid interpretation of GPR139 mutagenesis data?

When conducting and interpreting GPR139 mutagenesis studies, researchers should address these critical considerations:

  • Expression level normalization: Ensure comparable membrane expression of wild-type and mutant receptors to avoid confounding functional changes with expression differences

  • Multiple functional readouts: Characterize mutants using both calcium mobilization and radioligand binding to distinguish effects on signaling efficacy versus binding affinity

  • Structural context: Interpret mutations based on their location relative to predicted domains - mutations in the orthosteric binding site typically affect ligand sensitivity, while those in G-protein binding regions or helix structures often cause loss-of-function

  • Ligand panels: Test multiple ligands on each mutant to identify ligand-specific effects that may reveal distinct binding modes

  • Homology model integration: Incorporate mutagenesis data into structural models to visualize spatial relationships between mutations and functional domains

  • Correlation with conservation: Consider the evolutionary conservation of mutated residues, as highly conserved positions often have critical functional roles

This comprehensive approach provides insights into structure-function relationships of GPR139 and can guide the design of both novel ligands and transgenic animal models .

How can researchers distinguish direct GPR139 effects from downstream signaling consequences?

Differentiating direct GPR139-mediated effects from downstream signaling requires sophisticated experimental design:

  • Temporal resolution: Employ rapid detection methods to identify immediate signaling events (seconds to minutes) versus delayed responses involving downstream cascades

  • Pharmacological dissection: Apply selective inhibitors targeting specific pathways to determine which downstream components are necessary for observed effects

  • Pathway-selective ligands: When available, use biased ligands that preferentially activate Gq/11 versus Gi/o pathways to attribute outcomes to specific signaling branches

  • Electrophysiological approaches: Conduct real-time recordings of neuronal activity following GPR139 modulation to distinguish direct versus network-mediated responses

  • Site-specific manipulations: Compare effects of systemic versus local (e.g., habenular) administration of GPR139 ligands, as demonstrated in addiction models

  • Correlation with knockout phenotypes: Determine whether acute pharmacological manipulation replicates or opposes phenotypes observed in GPR139 knockout animals

This approach is particularly important given GPR139's dual coupling to Gq/11 and Gi/o pathways, which may have distinct or even opposing functional consequences depending on cellular context .

What experimental paradigms best reveal GPR139's role in neuropsychiatric conditions?

To investigate GPR139's relevance to neuropsychiatric conditions, researchers should implement these evidence-based paradigms:

  • Comprehensive behavioral phenotyping: Assess GPR139 knockout or pharmacologically manipulated animals across multiple behavioral domains relevant to psychiatric symptoms

  • Sensorimotor gating: Evaluate pre-pulse inhibition, which is completely abolished in GPR139 knockout mice, providing a robust translational measure of sensorimotor processing deficits relevant to schizophrenia

  • Addiction models: Test GPR139 ligands in models of substance dependence, particularly alcohol dependence where efficacy has been demonstrated

  • Anxiety and fear conditioning: Assess effects on emotional learning and anxiety-related behaviors, which are disrupted in GPR139 knockout mice

  • Social interaction paradigms: Evaluate social behavior deficits, which have been observed in GPR139 null mutants

  • Drug interaction studies: Examine how GPR139 ligands modify responses to established psychiatric medications, building on observations that haloperidol and naltrexone can rescue certain phenotypes in GPR139 knockout mice

  • Translation to human genetics: Correlate experimental findings with analyses of GPR139 genetic variants in psychiatric populations

The diverse neuropsychiatric phenotypes of GPR139 knockout mice suggest this receptor may have relevance to multiple psychiatric conditions, particularly those involving dopaminergic or opioidergic dysfunction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.