Recombinant Human Probable G-protein coupled receptor 150 (GPR150)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant GPR150 is synthesized using multiple expression systems, each optimized for specific research applications.

Host Systems

HostAdvantagesExample Product (Source)
HEK293T CellsPost-translational modifications; mammalian foldingBoster Bio PROTQ8NGU9
E. coliCost-effective; high yieldCusabio CSB-CF839902HU
BaculovirusLarge-scale productionOrigene TP323227

Common Tags

  • C-Myc/DDK: Facilitates purification and detection (Boster Bio) .

  • His-Tag: Enables nickel-affinity chromatography (Creative BioMart) .

Biochemical Properties

Recombinant GPR150 is validated for purity, stability, and functionality.

ParameterSpecificationSource
Purity>80% (SDS-PAGE, Coomassie staining) Boster Bio, Origene
Concentration>50 µg/mL (microplate BCA assay) Boster Bio
Storage-80°C in PBS + 10% glycerol Boster Bio, Cusabio

Pathways and Interactions

GPR150 is linked to signaling pathways involving cAMP modulation and circadian rhythm regulation . Key interacting partners include:

ProteinInteraction RoleMethod of Detection
GPR176Co-regulates cAMP productionYeast two-hybrid
GNASG-protein subunit for signal transductionCo-IP
OXT (Oxytocin)Vasopressin-like subfamily memberTextmining

Disease Associations

  • Ovarian Cancer: Silencing via promoter methylation correlates with tumor progression .

  • Pain Signaling: Expressed in dorsal root ganglia neurons; potential target for osteoarthritis pain .

Research Applications

Recombinant GPR150 is critical for:

  • Drug Discovery: Screening for ligands targeting orphan GPCRs .

  • Mechanistic Studies: Elucidating roles in circadian rhythms and cancer .

  • Antibody Validation: Used as a positive control in Western blotting and immunohistochemistry .

Future Directions

Current research prioritizes:

  • Identifying endogenous ligands for GPR150 .

  • Exploring its role in metabolic disorders and neuronal signaling .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR150; Probable G-protein coupled receptor 150
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MEDLFSPSILPPAPNISVPILLGWGLNLTLGQGAPASGPPSRRVRLVFLGVILVVAVAGN TTVLCRLCGGGGPWAGPKRRKMDFLLVQLALADLYACGGTALSQLAWELLGEPRAATGDL ACRFLQLLQASGRGASAHLVVLIALERRRAVRLPHGRPLPARALAALGWLLALLLALPPA FVVRGDSPSPLPPPPPPTSLQPGAPPAARAWPGERRCHGIFAPLPRWHLQVYAFYEAVAG FVAPVTVLGVACGHLLSVWWRHRPQAPAAAAPWSASPGRAPAPSALPRAKVQSLKMSLLL ALLFVGCELPYFAARLAAAWSSGPAGDWEGEGLSAALRVVAMANSALNPFVYLFFQAGDC RLRRQLRKRLGSLCCAPQGGAEDEEGPRGHQALYRQRWPHPHYHHARREPLDEGGLRPPP PRPRPLPCSCESAF
Uniprot No.

Target Background

Function
Orphan receptor.
Database Links

HGNC: 23628

KEGG: hsa:285601

STRING: 9606.ENSP00000369344

UniGene: Hs.143315

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR150 and how is it classified within the GPCR superfamily?

GPR150 (G-protein coupled receptor 150) is classified as a Class A (rhodopsin-like) GPCR. Like other members of this family, it possesses the characteristic seven-transmembrane domain structure and likely signals through heterotrimeric G proteins. Class A represents the largest subfamily of GPCRs and includes well-characterized receptors such as adrenergic receptors, histamine receptors, and opioid receptors .

The classification is based on sequence homology and structural characteristics. GPR150 remains an orphan receptor, meaning its endogenous ligand has not yet been definitively identified. While many GPCRs couple to specific G protein families (Gs, Gi/o, Gq/11, or G12/13), the coupling profile of GPR150 remains to be fully characterized through experimental validation .

Methodological approach for classification studies:

  • Sequence alignment with known GPCRs

  • Phylogenetic analysis to determine evolutionary relationships

  • Structural prediction through homology modeling

  • Experimental G protein coupling assays similar to those used for other GPCRs

What expression systems are most suitable for producing functional recombinant GPR150?

Several expression systems can be employed for producing recombinant GPR150, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical YieldPost-translational Modifications
HEK293/HEK293TNative mammalian PTMs, good for functional studiesLower yieldsLow-MediumComplete
CHO cellsStable expression, scalableTime-consuming to develop stable linesMediumComplete
Sf9/Hi5 insect cellsHigher expression levelsDifferent glycosylation patternsHighPartial
Pichia pastorisHigh-density culture, cost-effectiveGlycosylation differencesMedium-HighDifferent pattern

For functional studies, mammalian expression systems (particularly HEK293 cells) are recommended as they provide the most physiologically relevant post-translational modifications and cellular environment. For structural studies requiring larger protein quantities, insect cell systems using baculovirus expression vectors may be more appropriate .

Methodological considerations:

  • Include epitope tags (FLAG, HA, His) for detection and purification

  • Optimize codon usage for the chosen expression system

  • Consider including fusion partners to enhance expression and membrane trafficking

  • Validate functional activity through G protein coupling assays similar to those used for GPR15

How can researchers validate the functional activity of recombinant GPR150?

Without known endogenous ligands, validating GPR150 functionality requires multiple approaches:

  • Expression validation:

    • Western blotting with anti-tag antibodies

    • Flow cytometry to confirm surface expression

    • Immunofluorescence to verify membrane localization

  • Functional coupling assessment:

    • BRET-based G protein activation assays testing multiple Gα subtypes (Gi1, Gi2, Gi3, GoA, GoB, Gz, Gs, Gq, G11, G15, G13) similar to methods used for GPR15

    • Second messenger assays:

      • cAMP accumulation (for Gs/Gi coupling)

      • Calcium mobilization (for Gq coupling)

      • RhoA activation (for G12/13 coupling)

    • Use of pathway-specific inhibitors (e.g., pertussis toxin for Gi/o pathways)

  • Constitutive activity assessment:

    • Compare basal signaling levels between GPR150-expressing cells and control cells

    • Inverse agonist screening if constitutive activity is detected

Data analysis should include dose-response relationships, activation kinetics, and statistical comparison with appropriate controls including other well-characterized GPCRs.

What are common challenges in expressing GPR150 and how can they be overcome?

Several challenges are common when working with orphan GPCRs like GPR150:

  • Low surface expression:

    • Optimize signal peptide sequences

    • Include chaperones (e.g., CANX, CALR) to improve folding

    • Create fusion constructs with well-expressed membrane proteins

    • Use chemical chaperones like glycerol or DMSO

  • Protein instability:

    • Screen detergents systematically (DDM, LMNG, GDN)

    • Include cholesterol hemisuccinate (CHS) during purification

    • Perform thermostability assays to identify stabilizing conditions

  • Lack of functional assays without known ligands:

    • Utilize constitutive activity as a readout

    • Develop chimeric receptors with known GPCRs

    • Explore random peptide libraries for activating ligands

  • Low signal-to-noise ratio in signaling assays:

    • Use BRET-based assays with improved sensors

    • Develop cell lines with minimal endogenous GPCR expression

    • Employ biosensors with enhanced sensitivity

How can researchers determine the G protein coupling profile of GPR150?

Determining G protein coupling is crucial for understanding GPR150 signaling. A comprehensive approach should include:

  • Direct G protein activation assays:

    • BRET-based assays measuring interaction between Gα and Gβγ subunits across multiple G protein subtypes (as described for GPR15)

    • Bioluminescent assays where masGRK3ct-Nluc serves as BRET energy donor anchored to the cell membrane, and Venus-tagged Gβγ dimers serve as acceptors

    • Comparison of activation profiles across all four G protein families (Gi/o, Gs, Gq/11, G12/13)

  • Second messenger quantification:

    • cAMP modulation (for Gs/Gi coupling)

    • IP3 production and calcium flux (for Gq/11)

    • RhoA activation (for G12/13)

  • Pathway-specific inhibitors:

    • Pertussis toxin to block Gi/o signaling

    • YM-254890 to inhibit Gq/11 pathways

    • CRISPR/Cas9 knockout of specific G proteins to confirm coupling

Analysis should include:

  • Potency (EC50) determination for each pathway

  • Efficacy (Emax) comparison across pathways

  • Activation kinetics analysis

  • Biased signaling quantification using operational models

This approach would mirror methods used for GPR15, where researchers determined preferential coupling to Gi/o rather than other pathways and further investigated specific Gi/o subtypes (Gi1, Gi2, Gi3, GoA, GoB, Gz) .

What strategies can identify potential ligands for orphan GPR150?

Ligand identification for orphan GPCRs requires multiple parallel approaches:

  • Computational methods:

    • Homology modeling based on related GPCRs with known structures

    • Virtual screening of compound libraries against predicted binding pocket

    • Pharmacophore modeling using related receptor ligands

    • Molecular dynamics simulations to identify potential binding sites

  • High-throughput screening:

    • Functional cell-based assays measuring G protein activation

    • BRET-based β-arrestin recruitment assays

    • Label-free assays (dynamic mass redistribution)

    • Screening diverse compound libraries (small molecules, peptides, biologics)

  • Deorphanization strategies:

    • Tissue extract fractionation from high-expression tissues

    • Reverse pharmacology approaches

    • Systematic screening of candidate endogenous molecules

    • Transcriptional correlation analysis to identify potential ligand-receptor pairs

  • Innovative approaches:

    • Chemogenomic analysis based on ligands of related GPCRs

    • Development of surrogate activation systems

    • CRISPR activation/repression screening to identify pathways

For orphan GPCRs, screening conditions should include various buffer compositions, pH levels, and cellular contexts, as activation conditions may be highly specific.

How can researchers investigate potential dimerization of GPR150 and its functional implications?

GPCR dimerization can significantly impact receptor pharmacology and function:

  • Biophysical methods to detect dimerization:

    • Resonance energy transfer techniques:

      • BRET between differently tagged receptor variants

      • FRET with fluorescent protein fusions

      • Time-resolved FRET for improved sensitivity

    • Protein complementation assays:

      • Split luciferase complementation

      • Bimolecular fluorescence complementation

    • Co-immunoprecipitation with differentially tagged receptors

    • Single-molecule imaging techniques

  • Functional consequences assessment:

    • Changes in G protein coupling preferences

    • Altered ligand binding properties and cooperativity

    • Modified trafficking and internalization dynamics

    • Signaling cross-talk between protomers

  • Potential heterodimer partners:

    • Closely related orphan GPCRs

    • GPCRs with overlapping tissue expression

    • Testing with known dimerizing GPCRs as positive controls

  • Analysis approaches:

    • Concentration-dependence studies

    • Competition with interfering peptides derived from transmembrane domains

    • Computational prediction of dimerization interfaces

    • Mutagenesis of predicted interface residues

Results should be interpreted cautiously, with appropriate controls to distinguish specific dimerization from non-specific aggregation.

What experimental approaches can elucidate the structure-function relationships in GPR150?

Understanding structure-function relationships requires systematic investigation:

  • Mutagenesis studies targeting:

    • Conserved motifs in Class A GPCRs (DRY, NPxxY, CWxP)

    • Predicted ligand binding pocket residues

    • Intracellular loops involved in G protein coupling

    • Extracellular domains potentially involved in ligand recognition

    • Residues potentially involved in dimerization

  • Chimeric receptor approaches:

    • Domain swapping with well-characterized GPCRs

    • Systematic replacement of loops and transmembrane regions

    • Creation of receptors with altered G protein coupling preferences

  • Structural biology approaches:

    • Homology modeling based on related GPCRs

    • Cryo-EM structure determination if expression levels permit

    • Hydrogen-deuterium exchange mass spectrometry

    • Disulfide cross-linking to probe conformational changes

  • Functional readouts for mutants:

    • Surface expression levels (distinguish trafficking from functional defects)

    • Constitutive activity (basal signaling)

    • G protein coupling efficiency

    • Receptor internalization and trafficking

Data integration should correlate structural elements with specific functional outcomes, building a comprehensive map of critical residues and domains.

How can biased signaling at GPR150 be investigated and what are its potential implications?

Biased signaling (preferential activation of certain pathways over others) has significant implications for drug development:

  • Experimental approaches:

    • Parallel measurement of multiple signaling pathways:

      • G protein activation via BRET

      • β-arrestin recruitment

      • Receptor internalization

      • ERK phosphorylation

    • Calculation of bias factors using operational models

    • Kinetic analysis of different signaling events

    • Phosphorylation site mapping to correlate with pathway activation

  • Tool development:

    • Creation of phospho-deficient mutants

    • Development of pathway-specific biosensors

    • Construction of G protein-uncoupled mutants

  • Potential implications:

    • Therapeutic advantage through selective pathway activation

    • Understanding of complex physiological responses

    • Identification of pathway-specific functions

    • Development of ligands with improved side effect profiles

  • Analysis frameworks:

    • Black and Leff operational model

    • Kinetic context quantification

    • Systems biology modeling of integrated pathways

This approach mirrors investigations of other GPCRs where differential G protein coupling has been demonstrated, such as the preferential coupling of GPR15 to Gi/o rather than other G protein families .

What are the optimal purification strategies for recombinant GPR150?

Purifying GPCRs requires specialized approaches to maintain structural integrity and function:

  • Solubilization optimization:

    • Systematic screening of detergents:

      • Classical detergents (DDM, DM)

      • Newer detergents (LMNG, GDN)

      • Styrene maleic acid lipid particles (SMALPs)

    • Addition of stabilizing lipids (CHS, specific phospholipids)

    • Buffer optimization (pH, salt concentration, additives)

  • Affinity purification:

    • Epitope tag selection (His, FLAG, 1D4, etc.)

    • Single-step vs. tandem affinity purification

    • On-column detergent exchange

    • Elution condition optimization to maintain stability

  • Size exclusion chromatography:

    • Assessment of monodispersity

    • Removal of aggregates

    • Buffer optimization during SEC

    • Analysis of oligomeric state

  • Quality control metrics:

    • SDS-PAGE and Western blotting

    • Thermostability assays (CPM, FSEC-TS)

    • Mass spectrometry for intact mass and modifications

    • Functional validation post-purification

DetergentCMC (mM)AdvantagesLimitationsRecommended Concentration
DDM0.17Well-characterizedLarger micelles1% for extraction, 0.1% for purification
LMNG0.01Small micelles, high stabilityExpensive1% for extraction, 0.01% for purification
GDN0.018Enhanced stabilityLimited availability1% for extraction, 0.02% for purification
SMAN/ANative lipid environmentpH limitations2.5% w/v polymer

The purification strategy should be tailored to the intended application, with structural studies requiring higher purity and stability than functional assays.

What tissue expression profile is expected for GPR150 and how can this guide functional studies?

Understanding tissue expression patterns provides crucial insights for functional investigation:

  • Expression analysis methods:

    • RT-qPCR across diverse tissues

    • RNA-seq data mining from public databases

    • Immunohistochemistry with validated antibodies

    • Single-cell RNA sequencing for cellular resolution

    • In situ hybridization for spatial localization

  • Expected expression pattern based on related orphan GPCRs:

    • Potential for enrichment in specific brain regions

    • Possible expression in endocrine tissues

    • Potential immune cell expression

    • Developmental regulation considerations

  • Functional study design based on expression:

    • Selection of physiologically relevant cell models

    • Development of tissue-specific knockout models

    • Design of ex vivo assays from high-expression tissues

    • Correlation with related signaling pathways in expressing tissues

  • Methodological considerations:

    • Validation with multiple approaches

    • Inclusion of positive and negative control tissues

    • Consideration of splice variants

    • Comparison across species for evolutionary conservation

This information guides the selection of appropriate cell types for functional studies and suggests potential physiological roles based on expression patterns.

How can researchers develop selective antibodies against GPR150?

Developing selective antibodies against GPCRs presents unique challenges:

  • Antigen design strategies:

    • Peptides from extracellular domains:

      • N-terminal domain peptides

      • Extracellular loop peptides

      • Combined epitope approaches

    • Recombinant protein fragments

    • DNA immunization with full-length GPR150

    • Cell-based immunization with overexpressing cells

  • Production approaches:

    • Polyclonal antibodies for initial characterization

    • Monoclonal antibody development

    • Phage display for synthetic antibody fragments

    • Single B-cell cloning from immunized animals

  • Validation requirements:

    • Western blotting against recombinant GPR150

    • Flow cytometry on expressing vs. non-expressing cells

    • Immunoprecipitation followed by mass spectrometry

    • Knockout/knockdown controls

    • Cross-reactivity testing against related GPCRs

    • Native vs. denatured protein recognition

  • Application-specific considerations:

    • Conformation-specific antibodies

    • Phospho-specific antibodies for activation states

    • Function-modulating antibodies as research tools

    • Species cross-reactivity for translational studies

Each application may require different antibody characteristics, necessitating a multi-faceted approach to antibody development and validation.

What CRISPR-based approaches are most effective for studying GPR150 function?

CRISPR technology offers powerful tools for investigating orphan GPCRs:

  • Knockout strategies:

    • Complete gene knockout using paired gRNAs

    • Exon-specific targeting for functional domain analysis

    • Inducible knockout systems

    • Knockout validation methodologies:

      • Genomic sequencing

      • Protein expression verification

      • Off-target analysis

  • Knockin approaches:

    • Epitope tag insertion for detection

    • Fluorescent protein fusion for localization studies

    • Reporter gene knockin for expression analysis

    • Point mutations to test structure-function hypotheses

  • CRISPR activation/inhibition:

    • CRISPRa to upregulate endogenous expression

    • CRISPRi to repress expression

    • Multiplexed approaches to study pathway interactions

    • Timed activation/inhibition for developmental studies

  • Screening applications:

    • Genome-wide screens for GPR150 function modulators

    • Focused library screens targeting GPCR pathways

    • Synthetic lethality screens in GPR150-expressing cells

    • Combinatorial screens for pathway mapping

Careful design of guide RNAs, appropriate control selections, and thorough validation are essential for successful CRISPR-based studies.

What computational approaches can predict GPR150 structure and function?

Computational methods provide valuable insights when experimental data is limited:

  • Homology modeling approaches:

    • Template selection from structurally resolved Class A GPCRs

    • Model refinement through energy minimization

    • Validation through Ramachandran plots and quality metrics

    • Integration of experimental constraints when available

  • Molecular dynamics simulations:

    • Receptor behavior in membrane environment

    • Identification of potential binding pockets

    • Water and ion pathway analysis

    • Conformational changes during activation

  • Virtual screening applications:

    • Docking of compound libraries to identify potential ligands

    • Pharmacophore modeling based on related receptors

    • Fragment-based approaches for binding site mapping

    • Machine learning integration for improved predictions

  • Network analysis:

    • Prediction of protein-protein interactions

    • Pathway integration and cross-talk analysis

    • Evolutionary analysis to identify conserved features

    • Gene co-expression networks to suggest functions

These computational approaches should be iteratively refined as experimental data becomes available, creating a feedback loop between prediction and validation.

What strategies can develop selective modulators of GPR150 for research applications?

Developing selective modulators for orphan receptors requires systematic approaches:

  • Screening strategies:

    • High-throughput functional assays:

      • G protein activation assays

      • β-arrestin recruitment

      • Receptor internalization

    • Fragment-based screening

    • DNA-encoded library screening

    • Computational virtual screening

  • Structure-guided design:

    • Homology model-based ligand design

    • Pharmacophore development

    • Fragment growing and linking strategies

    • Allosteric modulator development

  • Tool compound development:

    • Photoaffinity probes for binding site identification

    • Fluorescent ligands for binding studies

    • Radiolabeled compounds for binding assays

    • Biotinylated compounds for pull-down studies

  • Selectivity profiling:

    • Counter-screening against related GPCRs

    • Broad off-target screening

    • In vitro safety profiling

    • Biased signaling characterization

The G protein coupling profile is particularly important for assay development, as demonstrated by the GPR15 studies showing preferential Gi/o coupling .

How can single-cell approaches advance our understanding of GPR150 biology?

Single-cell technologies provide unprecedented resolution for receptor studies:

  • Single-cell transcriptomics:

    • Identification of GPR150-expressing cell populations

    • Correlation with other signaling components

    • Developmental trajectory analysis

    • Disease-associated expression changes

  • Spatial transcriptomics:

    • Tissue localization with cellular resolution

    • Microenvironment analysis

    • Cell-cell interaction mapping

    • Correlation with functional tissue domains

  • Single-cell proteomics:

    • Protein-level confirmation of expression

    • Post-translational modification analysis

    • Signaling pathway activation states

    • Correlation with functional readouts

  • Single-cell functional assays:

    • Calcium imaging in primary cells

    • Single-cell BRET/FRET for signaling

    • Electrophysiological recordings

    • Secretion analysis from individual cells

Integration of these approaches provides a comprehensive understanding of GPR150 biology in physiologically relevant contexts.

What considerations are important when evaluating GPR150 as a potential therapeutic target?

Assessing GPR150 as a therapeutic target requires systematic evaluation:

  • Target validation criteria:

    • Genetic evidence from human studies

    • Expression correlation with disease states

    • Functional evidence from model systems

    • Druggability assessment

  • Disease relevance assessment:

    • Expression in disease-relevant tissues

    • Pathway involvement in pathological processes

    • Genetic association studies

    • Phenotypic effects of modulation

  • Safety considerations:

    • Expression in critical tissues (brain, heart)

    • Developmental roles

    • Potential for on-target adverse effects

    • Redundancy with related receptors

  • Therapeutic modality selection:

    • Small molecule feasibility

    • Antibody accessibility

    • Peptide agonist/antagonist potential

    • Biased ligand opportunities

The high proportion of successful GPCR-targeted drugs (approximately 35% of all approved drugs target GPCRs) suggests that orphan GPCRs like GPR150 may represent valuable untapped therapeutic opportunities.

How might novel technologies advance GPR150 deorphanization efforts?

Emerging technologies present new opportunities for orphan GPCR research:

  • Advanced screening approaches:

    • DNA-encoded chemical libraries

    • CRISPR activation/inhibition screens

    • Spatial transcriptomics integration

    • Artificial intelligence-driven virtual screening

  • Novel biosensor technologies:

    • GPCR conformation-specific sensors

    • Nanobody-based biosensors

    • Genetically encoded indicators for G protein subtypes

    • Single-molecule tracking in native environments

  • Innovative structural biology methods:

    • Cryo-EM advances for membrane proteins

    • Integration of AlphaFold predictions

    • Mass photometry for native complex analysis

    • Hydrogen-deuterium exchange mass spectrometry

  • Systems biology integration:

    • Multi-omics data integration

    • Network pharmacology approaches

    • In silico modeling of GPCR signaling networks

    • Patient-derived models for translational insights

These technologies, when applied systematically, significantly increase the probability of successful deorphanization and functional characterization.

What experimental approaches can determine the physiological role of GPR150?

Determining physiological functions requires complementary approaches:

  • Genetic models:

    • Knockout mouse generation

    • Conditional and inducible knockout systems

    • Tissue-specific overexpression models

    • Humanized mouse models

  • Phenotypic characterization:

    • Comprehensive phenotyping protocols

    • Metabolic assessment

    • Behavioral testing if expressed in CNS

    • Immune function if expressed in immune cells

    • Developmental analysis

  • Multi-system analysis:

    • Transcriptomic profiling of knockout tissues

    • Metabolomic analysis

    • Signaling pathway investigation

    • Interactome mapping

  • Human genetic correlation:

    • Analysis of GPR150 variants in population databases

    • Correlation with phenotypic traits

    • Investigation in relevant patient cohorts

    • Functional characterization of identified variants

Integrating data from these approaches provides a comprehensive understanding of GPR150's physiological significance and potential as a therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.