Recombinant Human Probable G-protein coupled receptor 152 (GPR152)

Shipped with Ice Packs
In Stock

Description

Introduction to GPR152

GPR152 is classified as an orphan G-protein coupled receptor, meaning its endogenous ligand remains unidentified. The human GPR152 was initially discovered as hGPCR38 and as anonymous heat-stable fragment RP8-9Q (comprising 199 residues) . This receptor belongs to the rhodopsin γ-receptor subfamily within the broader GPCR family, which constitutes one of the largest protein families in the human genome . GPR152 is also known by the alternative name G protein-coupled receptor PGR5, highlighting its classification within the G-protein signaling system .

The GPR152 gene is strategically positioned on human chromosome 11q13.2, while its mouse ortholog is located on chromosome 19A . As a member of the GPCR superfamily, GPR152 participates in diverse physiological functions and represents a potential target for pharmacological interventions, consistent with the therapeutic significance of many other members of this receptor family .

Recombinant Forms

Recombinant human GPR152 is available in various forms for research applications. One common variant is a recombinant protein antigen with an N-terminal His6-ABP tag corresponding to human GPR152 . This particular form has a molecular weight of approximately 26 kDa, which differs from the native protein due to the expression of partial sequences and the addition of affinity tags .

Commercial recombinant human GPR152 proteins typically maintain a purity level greater than or equal to 85% as determined by SDS-PAGE analysis . These proteins are produced using diverse expression systems, including E. coli, yeast, baculovirus, and mammalian cell lines, each offering different advantages for protein folding, post-translational modifications, and functional activity .

Expression Systems

The production of recombinant human GPR152 employs several expression platforms, each with distinct characteristics:

Expression SystemAdvantagesCommon Applications
E. coliHigh yield, cost-effective, rapid productionProtein antigens, blocking peptides
YeastPost-translational modifications, proper foldingFunctional studies, structural analysis
BaculovirusMammalian-like modifications, high expressionSignaling studies, functional assays
Mammalian CellNative-like processing and foldingDrug screening, binding assays

E. coli-derived recombinant GPR152, such as the commercially available protein antigen with N-terminal His6-ABP tag, is particularly suited for antibody competition assays and serves as a blocking peptide for validating antibody specificity .

Purification and Quality Control

Recombinant human GPR152 proteins are typically purified using immobilized metal affinity chromatography (IMAC), leveraging the presence of histidine tags . The purified proteins are formulated in buffers such as PBS with 1M urea at pH 7.4 to maintain stability .

Quality control measures for recombinant GPR152 include:

  1. SDS-PAGE analysis to confirm purity (typically ≥80-85%)

  2. Mass spectrometry to verify molecular weight

  3. Functional validation for specific applications

  4. Solubility and stability assessments

Proper storage recommendations for recombinant GPR152 include maintaining the protein at -20°C and avoiding repeated freeze-thaw cycles to preserve functionality .

Signaling Mechanisms

As a G protein-coupled receptor, GPR152 functions through canonical GPCR signaling pathways. The activity of GPR152 is primarily mediated by G proteins, resulting in the activation of adenylyl cyclase and subsequent elevation of intracellular cyclic adenosine monophosphate (cAMP) levels . This signaling cascade can initiate various downstream cellular responses depending on the cell type and physiological context.

While GPR152 remains classified as an orphan receptor with no identified endogenous ligand, its sequence homology with other receptors such as CRTH2 and FPRL1 suggests potential roles in inflammatory and immune-related processes .

Gene-Chemical Interactions

Research indicates that GPR152 expression and function can be modulated by various chemical compounds. Studies in rat models have documented numerous interactions, including:

  1. Benzo[a]pyrene effects on GPR152 methylation, influencing both promoter and exon regions

  2. Bisphenol A decreasing GPR152 mRNA expression

  3. Copper deficiency and dietary sucrose interactions leading to increased GPR152 mRNA expression

  4. Cuprizon producing both increased and decreased GPR152 expression depending on experimental conditions

  5. Azoxymethane in combination with dextran sulfate and titanium dioxide increasing GPR152 mRNA expression

These interactions highlight the potential responsiveness of GPR152 to environmental factors and xenobiotics, suggesting roles in toxicological responses and pathophysiological mechanisms.

Genomic Context and Identifiers

The human GPR152 gene is located on chromosome 11q13.2, a region associated with several disease conditions . Key identifiers for the human GPR152 gene and protein include:

DatabaseIdentifier
HGNC23622
NCBI Gene390212
EnsemblENSG00000175514
UniProtKB/Swiss-ProtQ8TDT2

The mouse ortholog (Gpr152) has the Entrez Gene ID 269053 and UniProt ID Q8BXS7, with aliases including Gm673 and A930009H15Rik .

Evolutionary Conservation

While the search results don't provide comprehensive information on evolutionary conservation, the structural and sequence differences between human and rodent GPR152, particularly in the C-terminal region, suggest evolutionary divergence that may reflect species-specific functional adaptations . The existence of orthologs across mammalian species indicates the evolutionary conservation of this receptor, highlighting its potential biological significance.

Disease Associations and Potential Clinical Relevance

Research has identified potential associations between GPR152 and several pathological conditions. Notable among these is the link between a 26-kb locus on 11q13.1 and diffuse-type gastric cancer, with the rs1790761 variant in GPR152 showing significant allelic associations with susceptibility to this disease . This genetic evidence suggests a possible role for GPR152 in cancer pathogenesis.

Additional disease associations reported for GPR152 include:

  1. Deafness, Autosomal Dominant 21

  2. Oliver-McFarlane Syndrome

These disease connections highlight the potential clinical relevance of GPR152 as a biomarker or therapeutic target, warranting further investigation into its pathophysiological roles.

Antibody Production and Validation

Recombinant human GPR152 proteins serve as critical tools for generating and validating antibodies against this receptor. Specifically, recombinant GPR152 protein antigens are employed as blocking peptides to confirm antibody specificity . For instance, commercially available GPR152 recombinant protein antigen has been validated for antibody competition assays, providing researchers with reliable reagents for immunological studies .

Functional Studies

Recombinant human GPR152 enables investigations into the functional properties of this orphan receptor. These studies may include:

  1. Ligand screening to identify potential endogenous or synthetic binding partners

  2. Signal transduction analysis to elucidate downstream pathways

  3. Structure-function relationship studies

  4. Protein-protein interaction assessments

Additionally, viral vectors expressing recombinant human GPR152, such as adeno-associated virus (AAV) systems, facilitate in vivo studies of GPR152 overexpression and its physiological consequences .

Future Research Directions

Despite advancing knowledge about GPR152, several aspects require further investigation:

  1. Identification of the endogenous ligand(s) for this orphan receptor

  2. Detailed characterization of GPR152 signaling pathways beyond adenylyl cyclase activation

  3. Exploration of GPR152's role in normal physiology and disease pathogenesis

  4. Development of specific agonists and antagonists as pharmacological tools and potential therapeutics

  5. Structural studies to elucidate the three-dimensional architecture of GPR152

These research directions would significantly enhance understanding of GPR152 biology and potentially reveal new therapeutic opportunities.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, should you have specific format requirements, kindly include them in your order notes. We will strive to accommodate your preferences.
Lead Time
Delivery timelines may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributors.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Typically, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms generally have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
GPR152; PGR5; Probable G-protein coupled receptor 152; G-protein coupled receptor PGR5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-470
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDTTMEADLGATGHRPRTELDDEDSYPQGGWDTVFLVALLLLGLPANGLMAWLAGSQARH GAGTRLALLLLSLALSDFLFLAAAAFQILEIRHGGHWPLGTAACRFYYFLWGVSYSSGLF LLAALSLDRCLLALCPHWYPGHRPVRLPLWVCAGVWVLATLFSVPWLVFPEAAVWWYDLV ICLDFWDSEELSLRMLEVLGGFLPFLLLLVCHVLTQATACRTCHRQQQPAACRGFARVAR TILSAYVVLRLPYQLAQLLYLAFLWDVYSGYLLWEALVYSDYLILLNSCLSPFLCLMASA DLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQV NPTLQPRSDPTAQPQLNPTAQPQSDPTAQPQLNLMAQPQSDSVAQPQADTNVQTPAPAAS SVPSPCDEASPTPSSHPTPGALEDPATPPASEGESPSSTPPEAAPGAGPT
Uniprot No.

Target Background

Function
Orphan receptor.
Database Links

HGNC: 23622

KEGG: hsa:390212

UniGene: Hs.567997

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR152 and how is it classified?

GPR152 is a G-protein-coupled receptor belonging to the Class A Orphans family of GPCRs. It's classified within the rhodopsin γ-receptor subfamily and contains seven transmembrane domains characteristic of the GPCR superfamily. The human GPR152 was originally discovered in the nr database as hGPCR38 and as an anonymous heat-stable fragment RP8-9Q (199 residues) . The receptor is encoded by the GPR152 gene located at chromosomal position 11q13.2, and the resulting protein has a molecular mass of approximately 50,962 Da .

What are the structural features that distinguish GPR152 from other GPCRs?

GPR152 exhibits several distinctive structural characteristics compared to other GPCRs. Most notably, the C-terminus of GPR152 is relatively long, with rodent variants having two additional sequence stretches in their C-termini (approximately 220 residues long in rodents) . Human GPR152 consists of 470 amino acids, while the mouse variant is longer at 511 amino acids, and the rat variant is shorter at 394 amino acids . In terms of sequence homology, GPR152 shares 29% identity with CRTH2 (chemoattractant receptor-homologous molecule expressed on TH2 cells) and 27% identity with FPRL1 (formyl-peptide receptor) . These structural features suggest distinct evolutionary and functional aspects that separate GPR152 from better-characterized GPCRs.

What is known about the signaling mechanisms of GPR152?

The activity of GPR152 is primarily mediated through G proteins, resulting in the activation of adenylyl cyclase and subsequent elevation of intracellular cAMP levels . As an orphan receptor, the endogenous ligand for GPR152 remains unknown, which presents significant challenges for fully characterizing its signaling cascade. Researchers investigating GPR152 signaling typically employ functional assays that measure changes in secondary messengers like cAMP or calcium mobilization following receptor activation. Further research is required to identify potential binding partners and downstream effectors that could expand our understanding of GPR152's role in cellular physiology.

What expression systems are most effective for producing recombinant human GPR152?

Several expression systems have been successfully employed for producing recombinant human GPR152, each with specific advantages for different research applications:

Expression SystemAdvantagesTypical Applications
E. coliHigh yield, cost-effective, rapid productionStructural studies, antibody generation, protein interaction assays
YeastPost-translational modifications, proper foldingFunctional studies, ligand screening
BaculovirusMammalian-like processing, high expression levelsFunctional assays, structural biology
Mammalian cellsNative-like folding and modifications, functional receptorSignaling studies, drug screening, trafficking analysis

For structural studies requiring large quantities of protein, E. coli systems typically provide the highest yields, though membrane protein folding can be challenging. For functional analyses, mammalian cell systems like HEK293 or CHO cells often provide more physiologically relevant results despite lower expression levels .

What are the common challenges in purifying recombinant GPR152 and how can they be overcome?

Purification of recombinant GPR152 presents several technical challenges common to membrane proteins:

  • Solubilization challenges: GPR152, with its seven transmembrane domains, requires careful selection of detergents for extraction from membranes. Researchers typically screen multiple detergent types (e.g., DDM, LMNG, or digitonin) at varying concentrations to identify optimal solubilization conditions that maintain protein stability and functionality.

  • Heterogeneity issues: Expression can result in multiple forms (unfolded, partially folded, and properly folded), requiring additional purification steps. Size-exclusion chromatography following initial affinity purification helps separate different conformational populations.

  • Stability concerns: GPR152 may exhibit poor stability once removed from the membrane environment. Addition of cholesterol or specific lipids to purification buffers, use of stabilizing ligands (if known), and optimization of buffer conditions (pH, salt concentration) can significantly improve stability during purification.

  • Low yield: Partial tagging strategies (e.g., adding His-tags or FLAG-tags) and optimized purification protocols incorporating multiple chromatography steps (affinity, ion exchange, and size exclusion) can improve yield while maintaining protein quality.

How can researchers determine if recombinant GPR152 is functionally active?

Assessing the functional activity of recombinant GPR152 requires multiple complementary approaches:

  • cAMP accumulation assays: Since GPR152 activates adenylyl cyclase, measuring cAMP levels using ELISA-based methods or real-time biosensors (e.g., BRET-based or FRET-based systems) can confirm functional coupling to G proteins .

  • G protein coupling assays: BRET or FRET-based approaches measuring the interaction between GPR152 and various G protein subunits can identify specific G protein coupling preferences.

  • β-arrestin recruitment: Although not explicitly described for GPR152 in the literature, arrestin recruitment assays can evaluate potential arrestin-dependent signaling and receptor internalization.

  • Constitutive activity analysis: As an orphan receptor, GPR152 may exhibit constitutive activity. Comparing signaling levels in GPR152-expressing cells versus control cells can identify basal activity levels.

  • Mutagenesis validation: Creating mutants of key residues predicted to be involved in G protein coupling (based on homology with related receptors) and measuring changes in signaling can validate functional regions of the receptor.

What approaches can be used to identify potential ligands for orphan GPR152?

Identifying ligands for orphan receptors like GPR152 requires systematic screening approaches:

  • Bioinformatic prediction: Computational analysis comparing GPR152 structure to related receptors with known ligands can guide initial screening efforts. The 29% identity with CRTH2 and 27% with FPRL1 provides starting points for candidate ligand classes .

  • Tissue-specific metabolite screening: Since GPR152 shows allelic associations with gastric cancer, screening metabolites or peptides from relevant tissues may identify potential endogenous ligands .

  • High-throughput compound library screening: Using cell-based assays measuring cAMP production, calcium mobilization, or receptor internalization to screen compound libraries can identify synthetic ligands that may provide tools for further receptor characterization.

  • Reverse pharmacology approach: Comparing gene expression profiles in cells with and without GPR152 expression under various stimuli can identify pathways potentially activated by the receptor, guiding more targeted ligand screening.

  • Proximity-based interactome analysis: Using BioID or APEX2 techniques to identify proteins that interact with GPR152 in cellular contexts may reveal binding partners that could lead to ligand identification.

What is known about GPR152's association with gastric cancer?

Research has identified a significant association between GPR152 and diffuse-type gastric cancer. Specifically, a 26-kb locus on chromosome 11q13.1 has been linked to this cancer type, and the single nucleotide polymorphism rs1790761 in the GPR152 gene shows significant allelic associations with disease susceptibility . This suggests potential involvement of GPR152 in gastric cancer pathogenesis through mechanisms that remain to be fully elucidated.

For researchers investigating this connection, several methodological approaches are recommended:

  • Gene expression analysis comparing GPR152 levels in normal versus cancerous gastric tissues

  • Functional characterization of the rs1790761 polymorphism using reporter assays and CRISPR-based genome editing

  • Investigation of downstream signaling pathways in gastric cancer cell lines with modulated GPR152 expression

  • Analysis of potential correlations between GPR152 expression/activity and clinical outcomes in patient cohorts

How can GPR152 be targeted for therapeutic development in associated diseases?

Developing therapeutic strategies targeting GPR152 requires multiple converging approaches:

  • Structure-based drug design: Using computational modeling based on the known structural features of GPR152 and related receptors to design potential ligands targeting specific binding pockets.

  • Allosteric modulator screening: Identifying compounds that modulate receptor function without necessarily binding to the orthosteric site, which may offer more selective targeting.

  • Antibody-based approaches: Developing antibodies against extracellular domains of GPR152 that could modulate receptor function or be used for targeted delivery of therapeutics.

  • Gene therapy considerations: For diseases associated with GPR152 polymorphisms, CRISPR/Cas9 or antisense oligonucleotide approaches might be explored to correct or compensate for genetic variations.

  • Signaling pathway intervention: Targeting downstream components of GPR152 signaling may provide alternative therapeutic approaches when direct receptor targeting proves challenging.

What tools and reagents are available for GPR152 research?

The following research tools are currently available for studying GPR152:

Resource TypeAvailable OptionsApplicationsReference
AntibodiesHuman-reactive anti-GPR152 antibodiesWestern blot, Immunofluorescence, ELISA
Recombinant ProteinsFull-length and partial GPR152 from various expression systems (E. coli, yeast, baculovirus, mammalian)Structural studies, antibody generation, binding assays
Database ResourcesUniProt (Q8TDT2), GPCRdb, Alphafold structures, ChEMBL (CHEMBL4523900)Sequence analysis, structural modeling, comparative studies
Species VariantsHuman, Mouse, Rat GPR152 proteins and constructsComparative functional studies, model system research

Researchers should validate these tools in their specific experimental systems, as antibody specificity and recombinant protein functionality may vary between applications.

What are the best approaches for studying GPR152 structural dynamics?

Advanced structural analysis of GPR152 requires multiple complementary approaches:

  • Cryo-electron microscopy: This technique can potentially resolve the three-dimensional structure of GPR152 in various conformational states, though stabilization of the receptor remains challenging.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can provide insights into conformational dynamics and ligand-binding induced changes in GPR152 structure.

  • Site-directed mutagenesis coupled with functional assays: Systematic mutation of predicted key residues followed by functional testing can map important structural elements involved in GPR152 activation and signaling.

  • Molecular dynamics simulations: Computational approaches using available structural data can predict conformational changes and potential ligand binding sites.

  • Cross-linking coupled with mass spectrometry: This technique can capture transient interactions and conformational states of GPR152, providing insights into dynamic structural features that may not be apparent in static structural models.

What are the key unresolved questions in GPR152 research?

Several important questions remain unanswered about GPR152:

  • Endogenous ligand identification: The natural ligand(s) for GPR152 remains unknown, presenting a fundamental gap in understanding its physiological function.

  • Tissue-specific roles: While associations with gastric cancer exist, the normal physiological role of GPR152 in different tissues requires further investigation.

  • Signaling network characterization: Beyond the known activation of adenylyl cyclase, the complete signaling networks and regulatory mechanisms of GPR152 remain to be fully mapped.

  • Evolutionary significance: Understanding the reasons for the substantial differences in C-terminal length between human and rodent GPR152 may provide insights into its evolutionary adaptation and function.

  • Structure-function relationships: Detailed mapping of the structural elements responsible for GPR152's unique signaling properties would advance both basic understanding and drug development efforts.

What novel methodologies might advance GPR152 research in the near future?

Emerging technologies likely to impact GPR152 research include:

  • Single-cell analysis techniques: Applying single-cell RNA-seq and proteomics to understand cell-type specific expression patterns and signaling of GPR152 in complex tissues.

  • Nanobody development: Generating highly specific nanobodies against GPR152 conformational states to stabilize the receptor for structural studies and as potential research tools.

  • Organoid models: Using tissue-specific organoids to study GPR152 function in more physiologically relevant systems, particularly in contexts related to its disease associations.

  • CRISPR-based screening: High-throughput CRISPR activation or interference screens to identify genes that modulate GPR152 expression or function, revealing potential regulatory networks.

  • AI-driven modelling: Leveraging machine learning approaches to predict ligand interactions and signaling outcomes for GPR152 based on limited experimental data, accelerating discovery efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.